US20030170713A1 - Method of detecting androgen-regulated gene - Google Patents
Method of detecting androgen-regulated gene Download PDFInfo
- Publication number
- US20030170713A1 US20030170713A1 US10/390,045 US39004503A US2003170713A1 US 20030170713 A1 US20030170713 A1 US 20030170713A1 US 39004503 A US39004503 A US 39004503A US 2003170713 A1 US2003170713 A1 US 2003170713A1
- Authority
- US
- United States
- Prior art keywords
- androgen
- regulated
- polynucleotide
- prostate
- protein
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 239000003098 androgen Substances 0.000 title claims abstract description 506
- 230000001105 regulatory effect Effects 0.000 title claims abstract description 432
- 238000000034 method Methods 0.000 title claims abstract description 57
- 108090000623 proteins and genes Proteins 0.000 title claims description 231
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims abstract description 137
- 206010060862 Prostate cancer Diseases 0.000 claims abstract description 133
- 102000040430 polynucleotide Human genes 0.000 claims abstract description 67
- 108091033319 polynucleotide Proteins 0.000 claims abstract description 67
- 239000002157 polynucleotide Substances 0.000 claims abstract description 67
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 36
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 30
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 30
- 210000004027 cell Anatomy 0.000 claims description 177
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 158
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 153
- 108020004999 messenger RNA Proteins 0.000 claims description 152
- 229920001184 polypeptide Polymers 0.000 claims description 150
- 230000014509 gene expression Effects 0.000 claims description 119
- 210000002307 prostate Anatomy 0.000 claims description 86
- 239000000523 sample Substances 0.000 claims description 38
- 238000009396 hybridization Methods 0.000 claims description 37
- 230000004044 response Effects 0.000 claims description 20
- 239000013598 vector Substances 0.000 claims description 18
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 12
- 230000004060 metabolic process Effects 0.000 claims description 11
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 claims description 8
- 239000007787 solid Substances 0.000 claims description 6
- 230000015572 biosynthetic process Effects 0.000 claims description 5
- 210000005267 prostate cell Anatomy 0.000 claims description 4
- 229960003604 testosterone Drugs 0.000 claims description 4
- 210000004102 animal cell Anatomy 0.000 claims description 3
- 230000001580 bacterial effect Effects 0.000 claims description 3
- 239000012472 biological sample Substances 0.000 claims description 3
- 210000005253 yeast cell Anatomy 0.000 claims 1
- 238000004393 prognosis Methods 0.000 abstract description 8
- 238000003745 diagnosis Methods 0.000 abstract description 7
- 241000282414 Homo sapiens Species 0.000 description 234
- 239000002299 complementary DNA Substances 0.000 description 130
- 108010080146 androgen receptors Proteins 0.000 description 118
- 102100032187 Androgen receptor Human genes 0.000 description 108
- 108020004414 DNA Proteins 0.000 description 101
- 206010028980 Neoplasm Diseases 0.000 description 79
- 102000004169 proteins and genes Human genes 0.000 description 79
- 101000620365 Homo sapiens Protein TMEPAI Proteins 0.000 description 77
- 102100022429 Protein TMEPAI Human genes 0.000 description 77
- 235000018102 proteins Nutrition 0.000 description 74
- 108020004017 nuclear receptors Proteins 0.000 description 72
- 108020005497 Nuclear hormone receptor Proteins 0.000 description 71
- 108091034117 Oligonucleotide Proteins 0.000 description 64
- 239000012634 fragment Substances 0.000 description 53
- 201000011510 cancer Diseases 0.000 description 44
- 102000006255 nuclear receptors Human genes 0.000 description 44
- 239000012190 activator Substances 0.000 description 42
- 230000003993 interaction Effects 0.000 description 40
- 238000004458 analytical method Methods 0.000 description 32
- 230000006870 function Effects 0.000 description 31
- 108091060211 Expressed sequence tag Proteins 0.000 description 29
- 108091028043 Nucleic acid sequence Proteins 0.000 description 25
- 230000027455 binding Effects 0.000 description 25
- 239000013604 expression vector Substances 0.000 description 23
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 21
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 21
- 210000001519 tissue Anatomy 0.000 description 20
- 230000001419 dependent effect Effects 0.000 description 19
- 238000003752 polymerase chain reaction Methods 0.000 description 19
- 241000700159 Rattus Species 0.000 description 18
- 230000036961 partial effect Effects 0.000 description 17
- 210000000349 chromosome Anatomy 0.000 description 16
- 230000012010 growth Effects 0.000 description 16
- 235000001014 amino acid Nutrition 0.000 description 15
- 150000001413 amino acids Chemical class 0.000 description 15
- 239000000427 antigen Substances 0.000 description 15
- 108091007433 antigens Proteins 0.000 description 15
- 102000036639 antigens Human genes 0.000 description 15
- 238000005516 engineering process Methods 0.000 description 15
- 239000002773 nucleotide Substances 0.000 description 14
- 125000003729 nucleotide group Chemical group 0.000 description 14
- 230000003612 virological effect Effects 0.000 description 14
- 239000003814 drug Substances 0.000 description 13
- 230000001965 increasing effect Effects 0.000 description 13
- 102100025064 Cellular tumor antigen p53 Human genes 0.000 description 12
- 108700020796 Oncogene Proteins 0.000 description 12
- 229940079593 drug Drugs 0.000 description 12
- 230000006698 induction Effects 0.000 description 12
- 238000000746 purification Methods 0.000 description 12
- 230000011664 signaling Effects 0.000 description 12
- 238000006467 substitution reaction Methods 0.000 description 12
- 102000014914 Carrier Proteins Human genes 0.000 description 11
- 102000004190 Enzymes Human genes 0.000 description 11
- 108090000790 Enzymes Proteins 0.000 description 11
- 101001065832 Homo sapiens Low-density lipoprotein receptor class A domain-containing protein 4 Proteins 0.000 description 11
- 102100032094 Low-density lipoprotein receptor class A domain-containing protein 4 Human genes 0.000 description 11
- 238000000636 Northern blotting Methods 0.000 description 11
- 108091008324 binding proteins Proteins 0.000 description 11
- 230000000694 effects Effects 0.000 description 11
- 229940088598 enzyme Drugs 0.000 description 11
- 210000002919 epithelial cell Anatomy 0.000 description 11
- 239000012528 membrane Substances 0.000 description 11
- 239000000047 product Substances 0.000 description 11
- 102000005962 receptors Human genes 0.000 description 11
- 108020003175 receptors Proteins 0.000 description 11
- 101000721661 Homo sapiens Cellular tumor antigen p53 Proteins 0.000 description 10
- 108010072866 Prostate-Specific Antigen Proteins 0.000 description 10
- 102100038358 Prostate-specific antigen Human genes 0.000 description 9
- 108010076504 Protein Sorting Signals Proteins 0.000 description 9
- 108010022394 Threonine synthase Proteins 0.000 description 9
- 238000002679 ablation Methods 0.000 description 9
- 229940030486 androgens Drugs 0.000 description 9
- 230000033228 biological regulation Effects 0.000 description 9
- 238000007796 conventional method Methods 0.000 description 9
- 102000004419 dihydrofolate reductase Human genes 0.000 description 9
- 201000010099 disease Diseases 0.000 description 9
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 9
- 210000004408 hybridoma Anatomy 0.000 description 9
- 238000004519 manufacturing process Methods 0.000 description 9
- 239000011159 matrix material Substances 0.000 description 9
- 238000012545 processing Methods 0.000 description 9
- 238000013518 transcription Methods 0.000 description 9
- 241000588724 Escherichia coli Species 0.000 description 8
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 8
- 101000578249 Homo sapiens Homeobox protein Nkx-3.1 Proteins 0.000 description 8
- 230000004075 alteration Effects 0.000 description 8
- 238000003491 array Methods 0.000 description 8
- 230000001413 cellular effect Effects 0.000 description 8
- 229940088597 hormone Drugs 0.000 description 8
- 239000005556 hormone Substances 0.000 description 8
- 239000002609 medium Substances 0.000 description 8
- 239000013612 plasmid Substances 0.000 description 8
- 230000035897 transcription Effects 0.000 description 8
- 230000002103 transcriptional effect Effects 0.000 description 8
- 230000014616 translation Effects 0.000 description 8
- 102100035785 Acyl-CoA-binding protein Human genes 0.000 description 7
- 102000003780 Clusterin Human genes 0.000 description 7
- 108090000197 Clusterin Proteins 0.000 description 7
- 108091026890 Coding region Proteins 0.000 description 7
- 101710088194 Dehydrogenase Proteins 0.000 description 7
- 108010039287 Diazepam Binding Inhibitor Proteins 0.000 description 7
- 108700005087 Homeobox Genes Proteins 0.000 description 7
- 102100028092 Homeobox protein Nkx-3.1 Human genes 0.000 description 7
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 7
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 7
- 241001529936 Murinae Species 0.000 description 7
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 7
- 230000003321 amplification Effects 0.000 description 7
- 239000000090 biomarker Substances 0.000 description 7
- 210000004556 brain Anatomy 0.000 description 7
- 231100000504 carcinogenesis Toxicity 0.000 description 7
- 238000004113 cell culture Methods 0.000 description 7
- 230000004663 cell proliferation Effects 0.000 description 7
- 230000001404 mediated effect Effects 0.000 description 7
- 230000035772 mutation Effects 0.000 description 7
- 238000003199 nucleic acid amplification method Methods 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 238000013519 translation Methods 0.000 description 7
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 6
- 101100190829 Homo sapiens PMEPA1 gene Proteins 0.000 description 6
- 101000711466 Homo sapiens SAM pointed domain-containing Ets transcription factor Proteins 0.000 description 6
- 101710084064 Mitochondrial transcription factor 1 Proteins 0.000 description 6
- 239000004677 Nylon Substances 0.000 description 6
- 108090000708 Proteasome Endopeptidase Complex Proteins 0.000 description 6
- 102000004245 Proteasome Endopeptidase Complex Human genes 0.000 description 6
- 239000012980 RPMI-1640 medium Substances 0.000 description 6
- 102000040945 Transcription factor Human genes 0.000 description 6
- 108091023040 Transcription factor Proteins 0.000 description 6
- 102100026155 Transcription factor A, mitochondrial Human genes 0.000 description 6
- 102000044209 Tumor Suppressor Genes Human genes 0.000 description 6
- 108700025716 Tumor Suppressor Genes Proteins 0.000 description 6
- 239000002253 acid Substances 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 238000012512 characterization method Methods 0.000 description 6
- 238000001514 detection method Methods 0.000 description 6
- 238000011161 development Methods 0.000 description 6
- 230000018109 developmental process Effects 0.000 description 6
- 239000012091 fetal bovine serum Substances 0.000 description 6
- 102000037865 fusion proteins Human genes 0.000 description 6
- 108020001507 fusion proteins Proteins 0.000 description 6
- 230000002068 genetic effect Effects 0.000 description 6
- 230000001939 inductive effect Effects 0.000 description 6
- 239000003550 marker Substances 0.000 description 6
- 229920001778 nylon Polymers 0.000 description 6
- 230000023603 positive regulation of transcription initiation, DNA-dependent Effects 0.000 description 6
- 238000011472 radical prostatectomy Methods 0.000 description 6
- 230000010076 replication Effects 0.000 description 6
- 238000011160 research Methods 0.000 description 6
- 238000012216 screening Methods 0.000 description 6
- 230000019491 signal transduction Effects 0.000 description 6
- 150000003431 steroids Chemical class 0.000 description 6
- -1 sulfopropyl Chemical group 0.000 description 6
- 102100021569 Apoptosis regulator Bcl-2 Human genes 0.000 description 5
- 108020004635 Complementary DNA Proteins 0.000 description 5
- 108050006400 Cyclin Proteins 0.000 description 5
- 101000971171 Homo sapiens Apoptosis regulator Bcl-2 Proteins 0.000 description 5
- 230000004988 N-glycosylation Effects 0.000 description 5
- 108700026244 Open Reading Frames Proteins 0.000 description 5
- 102100032543 Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN Human genes 0.000 description 5
- 108091000080 Phosphotransferase Proteins 0.000 description 5
- 108010029485 Protein Isoforms Proteins 0.000 description 5
- 102000001708 Protein Isoforms Human genes 0.000 description 5
- 102100035934 Serine-threonine kinase receptor-associated protein Human genes 0.000 description 5
- 102000004962 Voltage-dependent anion channels Human genes 0.000 description 5
- 108090001129 Voltage-dependent anion channels Proteins 0.000 description 5
- 230000004913 activation Effects 0.000 description 5
- 230000000890 antigenic effect Effects 0.000 description 5
- 239000011324 bead Substances 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 238000010367 cloning Methods 0.000 description 5
- 238000012217 deletion Methods 0.000 description 5
- 230000037430 deletion Effects 0.000 description 5
- 229940011871 estrogen Drugs 0.000 description 5
- 239000000262 estrogen Substances 0.000 description 5
- 108020004445 glyceraldehyde-3-phosphate dehydrogenase Proteins 0.000 description 5
- 206010061289 metastatic neoplasm Diseases 0.000 description 5
- 230000002438 mitochondrial effect Effects 0.000 description 5
- 102000020233 phosphotransferase Human genes 0.000 description 5
- 208000023958 prostate neoplasm Diseases 0.000 description 5
- 108090000064 retinoic acid receptors Proteins 0.000 description 5
- 102000003702 retinoic acid receptors Human genes 0.000 description 5
- 230000032258 transport Effects 0.000 description 5
- 101150029129 AR gene Proteins 0.000 description 4
- 206010006187 Breast cancer Diseases 0.000 description 4
- 208000026310 Breast neoplasm Diseases 0.000 description 4
- 102100038214 Chromodomain-helicase-DNA-binding protein 4 Human genes 0.000 description 4
- 108010060434 Co-Repressor Proteins Proteins 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 4
- 102000016736 Cyclin Human genes 0.000 description 4
- 241000238631 Hexapoda Species 0.000 description 4
- 101000617830 Homo sapiens Sterol O-acyltransferase 1 Proteins 0.000 description 4
- 108010011536 PTEN Phosphohydrolase Proteins 0.000 description 4
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 4
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 4
- RJKFOVLPORLFTN-LEKSSAKUSA-N Progesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 RJKFOVLPORLFTN-LEKSSAKUSA-N 0.000 description 4
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 4
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 4
- 102100034018 SAM pointed domain-containing Ets transcription factor Human genes 0.000 description 4
- 102100021993 Sterol O-acyltransferase 1 Human genes 0.000 description 4
- 101710159478 Thioredoxin-like protein Proteins 0.000 description 4
- 102100022012 Transcription intermediary factor 1-beta Human genes 0.000 description 4
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 4
- 150000007513 acids Chemical class 0.000 description 4
- 125000000539 amino acid group Chemical group 0.000 description 4
- 230000006907 apoptotic process Effects 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 210000000481 breast Anatomy 0.000 description 4
- 238000006243 chemical reaction Methods 0.000 description 4
- 239000003153 chemical reaction reagent Substances 0.000 description 4
- 238000005094 computer simulation Methods 0.000 description 4
- 238000011156 evaluation Methods 0.000 description 4
- 230000004927 fusion Effects 0.000 description 4
- 230000013595 glycosylation Effects 0.000 description 4
- 238000006206 glycosylation reaction Methods 0.000 description 4
- 239000003102 growth factor Substances 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- 238000003780 insertion Methods 0.000 description 4
- 230000037431 insertion Effects 0.000 description 4
- 150000002632 lipids Chemical class 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 210000002752 melanocyte Anatomy 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 108010044762 nucleolin Proteins 0.000 description 4
- 230000037361 pathway Effects 0.000 description 4
- 210000002826 placenta Anatomy 0.000 description 4
- 108091008146 restriction endonucleases Proteins 0.000 description 4
- 230000028327 secretion Effects 0.000 description 4
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 4
- 239000007790 solid phase Substances 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 239000000758 substrate Substances 0.000 description 4
- 230000001225 therapeutic effect Effects 0.000 description 4
- 238000002560 therapeutic procedure Methods 0.000 description 4
- 230000009466 transformation Effects 0.000 description 4
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 3
- 102100023826 ADP-ribosylation factor 4 Human genes 0.000 description 3
- 101710139741 ADP-ribosylation factor 4 Proteins 0.000 description 3
- 108700001666 APC Genes Proteins 0.000 description 3
- 102100034044 All-trans-retinol dehydrogenase [NAD(+)] ADH1B Human genes 0.000 description 3
- 101710193111 All-trans-retinol dehydrogenase [NAD(+)] ADH4 Proteins 0.000 description 3
- DBKNLHKEVPZVQC-LPEHRKFASA-N Arg-Ala-Pro Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@@H]1C(O)=O DBKNLHKEVPZVQC-LPEHRKFASA-N 0.000 description 3
- CUQDCPXNZPDYFQ-ZLUOBGJFSA-N Asp-Ser-Asp Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O CUQDCPXNZPDYFQ-ZLUOBGJFSA-N 0.000 description 3
- 241000271566 Aves Species 0.000 description 3
- 108090001008 Avidin Proteins 0.000 description 3
- 102100035730 B-cell receptor-associated protein 31 Human genes 0.000 description 3
- 101710113110 B-cell receptor-associated protein 31 Proteins 0.000 description 3
- 102100037151 Barrier-to-autointegration factor Human genes 0.000 description 3
- 102000000584 Calmodulin Human genes 0.000 description 3
- 108010041952 Calmodulin Proteins 0.000 description 3
- 101001007681 Candida albicans (strain WO-1) Kexin Proteins 0.000 description 3
- 102000052052 Casein Kinase II Human genes 0.000 description 3
- 108010010919 Casein Kinase II Proteins 0.000 description 3
- 102000008169 Co-Repressor Proteins Human genes 0.000 description 3
- 102100027830 DNA repair protein XRCC2 Human genes 0.000 description 3
- 229920002307 Dextran Polymers 0.000 description 3
- XZWYTXMRWQJBGX-VXBMVYAYSA-N FLAG peptide Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=C(O)C=C1 XZWYTXMRWQJBGX-VXBMVYAYSA-N 0.000 description 3
- 102100033506 G-rich sequence factor 1 Human genes 0.000 description 3
- 102100024165 G1/S-specific cyclin-D1 Human genes 0.000 description 3
- 102100022887 GTP-binding nuclear protein Ran Human genes 0.000 description 3
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 3
- QSQXZZCGPXQBPP-BQBZGAKWSA-N Gly-Pro-Cys Chemical compound C1C[C@H](N(C1)C(=O)CN)C(=O)N[C@@H](CS)C(=O)O QSQXZZCGPXQBPP-BQBZGAKWSA-N 0.000 description 3
- 102100022846 Histone acetyltransferase KAT2B Human genes 0.000 description 3
- 101000883749 Homo sapiens Chromodomain-helicase-DNA-binding protein 4 Proteins 0.000 description 3
- 101000649306 Homo sapiens DNA repair protein XRCC2 Proteins 0.000 description 3
- 101000620756 Homo sapiens GTP-binding nuclear protein Ran Proteins 0.000 description 3
- 101001038755 Homo sapiens Guanylate cyclase soluble subunit alpha-1 Proteins 0.000 description 3
- 101001047006 Homo sapiens Histone acetyltransferase KAT2B Proteins 0.000 description 3
- 101000709305 Homo sapiens Replication protein A 14 kDa subunit Proteins 0.000 description 3
- 102000004157 Hydrolases Human genes 0.000 description 3
- 108090000604 Hydrolases Proteins 0.000 description 3
- 102100037852 Insulin-like growth factor I Human genes 0.000 description 3
- 102100034820 Mediator of RNA polymerase II transcription subunit 14 Human genes 0.000 description 3
- 102100025530 Mediator of RNA polymerase II transcription subunit 17 Human genes 0.000 description 3
- 102100039373 Membrane cofactor protein Human genes 0.000 description 3
- 102000010909 Monoamine Oxidase Human genes 0.000 description 3
- 108010062431 Monoamine oxidase Proteins 0.000 description 3
- 241000699666 Mus <mouse, genus> Species 0.000 description 3
- 101100460844 Mus musculus Nr2f6 gene Proteins 0.000 description 3
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 3
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 3
- KZNQNBZMBZJQJO-UHFFFAOYSA-N N-glycyl-L-proline Natural products NCC(=O)N1CCCC1C(O)=O KZNQNBZMBZJQJO-UHFFFAOYSA-N 0.000 description 3
- 108090000028 Neprilysin Proteins 0.000 description 3
- 102000003729 Neprilysin Human genes 0.000 description 3
- 102100021010 Nucleolin Human genes 0.000 description 3
- 102100020739 Peptidyl-prolyl cis-trans isomerase FKBP4 Human genes 0.000 description 3
- 102100037026 Peptidyl-prolyl cis-trans isomerase FKBP5 Human genes 0.000 description 3
- 102100037479 Peroxisomal membrane protein PEX16 Human genes 0.000 description 3
- 108090000029 Peroxisome Proliferator-Activated Receptors Proteins 0.000 description 3
- 102100038831 Peroxisome proliferator-activated receptor alpha Human genes 0.000 description 3
- 102100033008 Poly(U)-binding-splicing factor PUF60 Human genes 0.000 description 3
- 102100034080 Polyadenylate-binding protein-interacting protein 1 Human genes 0.000 description 3
- VPVHXWGPALPDGP-GUBZILKMSA-N Pro-Asn-Arg Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O VPVHXWGPALPDGP-GUBZILKMSA-N 0.000 description 3
- VVAWNPIOYXAMAL-KJEVXHAQSA-N Pro-Thr-Tyr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O VVAWNPIOYXAMAL-KJEVXHAQSA-N 0.000 description 3
- 102100033237 Pro-epidermal growth factor Human genes 0.000 description 3
- 101710120463 Prostate stem cell antigen Proteins 0.000 description 3
- 102100036735 Prostate stem cell antigen Human genes 0.000 description 3
- 108020004511 Recombinant DNA Proteins 0.000 description 3
- 102100034372 Replication protein A 14 kDa subunit Human genes 0.000 description 3
- 101710192171 Serine-threonine kinase receptor-associated protein Proteins 0.000 description 3
- 102100036768 Small nuclear ribonucleoprotein G Human genes 0.000 description 3
- 101000697584 Streptomyces lavendulae Streptothricin acetyltransferase Proteins 0.000 description 3
- UYTYTDMCDBPDSC-URLPEUOOSA-N Thr-Ile-Phe Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)O)NC(=O)[C@H]([C@@H](C)O)N UYTYTDMCDBPDSC-URLPEUOOSA-N 0.000 description 3
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 3
- 239000011543 agarose gel Substances 0.000 description 3
- 108010087924 alanylproline Proteins 0.000 description 3
- 230000000692 anti-sense effect Effects 0.000 description 3
- 210000000709 aorta Anatomy 0.000 description 3
- 108010043240 arginyl-leucyl-glycine Proteins 0.000 description 3
- 108010068380 arginylarginine Proteins 0.000 description 3
- 238000000376 autoradiography Methods 0.000 description 3
- 238000004364 calculation method Methods 0.000 description 3
- 230000005754 cellular signaling Effects 0.000 description 3
- 238000003776 cleavage reaction Methods 0.000 description 3
- 230000003081 coactivator Effects 0.000 description 3
- 230000001086 cytosolic effect Effects 0.000 description 3
- 229960002086 dextran Drugs 0.000 description 3
- 230000037149 energy metabolism Effects 0.000 description 3
- 239000003623 enhancer Substances 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 238000010195 expression analysis Methods 0.000 description 3
- 230000001605 fetal effect Effects 0.000 description 3
- 229940014144 folate Drugs 0.000 description 3
- 235000019152 folic acid Nutrition 0.000 description 3
- 239000011724 folic acid Substances 0.000 description 3
- 230000004077 genetic alteration Effects 0.000 description 3
- 231100000118 genetic alteration Toxicity 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 239000003163 gonadal steroid hormone Substances 0.000 description 3
- 230000003054 hormonal effect Effects 0.000 description 3
- 238000001727 in vivo Methods 0.000 description 3
- 239000003112 inhibitor Substances 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 239000003446 ligand Substances 0.000 description 3
- 108090000865 liver X receptors Proteins 0.000 description 3
- 102000004311 liver X receptors Human genes 0.000 description 3
- 210000004962 mammalian cell Anatomy 0.000 description 3
- 230000001394 metastastic effect Effects 0.000 description 3
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 3
- 239000000203 mixture Substances 0.000 description 3
- 230000001590 oxidative effect Effects 0.000 description 3
- 108700025694 p53 Genes Proteins 0.000 description 3
- 230000008488 polyadenylation Effects 0.000 description 3
- 230000002062 proliferating effect Effects 0.000 description 3
- 238000011158 quantitative evaluation Methods 0.000 description 3
- 238000004007 reversed phase HPLC Methods 0.000 description 3
- 150000003839 salts Chemical class 0.000 description 3
- 230000007017 scission Effects 0.000 description 3
- 239000006152 selective media Substances 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 238000001356 surgical procedure Methods 0.000 description 3
- 230000004083 survival effect Effects 0.000 description 3
- 108010067247 tacrolimus binding protein 4 Proteins 0.000 description 3
- 230000014621 translational initiation Effects 0.000 description 3
- 108010020532 tyrosyl-proline Proteins 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 108010023317 1-phosphofructokinase Proteins 0.000 description 2
- KVUXYQHEESDGIJ-UHFFFAOYSA-N 10,13-dimethyl-2,3,4,5,6,7,8,9,11,12,14,15,16,17-tetradecahydro-1h-cyclopenta[a]phenanthrene-3,16-diol Chemical compound C1CC2CC(O)CCC2(C)C2C1C1CC(O)CC1(C)CC2 KVUXYQHEESDGIJ-UHFFFAOYSA-N 0.000 description 2
- MKRXAIMALGQSHI-UHFFFAOYSA-N 2-[[2-[[2-[(2-amino-3-methylpentanoyl)amino]-3-methylpentanoyl]amino]-3-methylbutanoyl]amino]-3-methylbutanoic acid Chemical compound CCC(C)C(N)C(=O)NC(C(C)CC)C(=O)NC(C(C)C)C(=O)NC(C(C)C)C(O)=O MKRXAIMALGQSHI-UHFFFAOYSA-N 0.000 description 2
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 2
- OSJPPGNTCRNQQC-UWTATZPHSA-N 3-phospho-D-glyceric acid Chemical compound OC(=O)[C@H](O)COP(O)(O)=O OSJPPGNTCRNQQC-UWTATZPHSA-N 0.000 description 2
- 102100032921 ATP-dependent 6-phosphofructokinase, liver type Human genes 0.000 description 2
- 108091006112 ATPases Proteins 0.000 description 2
- 102000057290 Adenosine Triphosphatases Human genes 0.000 description 2
- 101710136834 Adenylyl cyclase-associated protein Proteins 0.000 description 2
- HXNNRBHASOSVPG-GUBZILKMSA-N Ala-Glu-Leu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O HXNNRBHASOSVPG-GUBZILKMSA-N 0.000 description 2
- QJABSQFUHKHTNP-SYWGBEHUSA-N Ala-Ile-Trp Chemical compound [H]N[C@@H](C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O QJABSQFUHKHTNP-SYWGBEHUSA-N 0.000 description 2
- ANNKVZSFQJGVDY-XUXIUFHCSA-N Ala-Val-Pro-Pro Chemical compound C[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 ANNKVZSFQJGVDY-XUXIUFHCSA-N 0.000 description 2
- UXJCMQFPDWCHKX-DCAQKATOSA-N Arg-Arg-Glu Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCC(O)=O)C(O)=O UXJCMQFPDWCHKX-DCAQKATOSA-N 0.000 description 2
- MFAMTAVAFBPXDC-LPEHRKFASA-N Arg-Asp-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC(=O)O)NC(=O)[C@H](CCCN=C(N)N)N)C(=O)O MFAMTAVAFBPXDC-LPEHRKFASA-N 0.000 description 2
- QAODJPUKWNNNRP-DCAQKATOSA-N Arg-Glu-Arg Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O QAODJPUKWNNNRP-DCAQKATOSA-N 0.000 description 2
- YBZMTKUDWXZLIX-UWVGGRQHSA-N Arg-Leu-Gly Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)NCC(O)=O YBZMTKUDWXZLIX-UWVGGRQHSA-N 0.000 description 2
- JQFZHHSQMKZLRU-IUCAKERBSA-N Arg-Lys Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@@H](N)CCCN=C(N)N JQFZHHSQMKZLRU-IUCAKERBSA-N 0.000 description 2
- IGFJVXOATGZTHD-UHFFFAOYSA-N Arg-Phe-His Natural products NC(CCNC(=N)N)C(=O)NC(Cc1ccccc1)C(=O)NC(Cc2c[nH]cn2)C(=O)O IGFJVXOATGZTHD-UHFFFAOYSA-N 0.000 description 2
- 102100038238 Aromatic-L-amino-acid decarboxylase Human genes 0.000 description 2
- VIRHEUMYXXLCBF-WDSKDSINSA-N Asp-Gly-Glu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(O)=O VIRHEUMYXXLCBF-WDSKDSINSA-N 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 241000972773 Aulopiformes Species 0.000 description 2
- 102100037586 B-cell receptor-associated protein 29 Human genes 0.000 description 2
- 101710113074 B-cell receptor-associated protein 29 Proteins 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 206010004446 Benign prostatic hyperplasia Diseases 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 102100021534 Calcium/calmodulin-dependent protein kinase kinase 2 Human genes 0.000 description 2
- 208000005623 Carcinogenesis Diseases 0.000 description 2
- 102100027992 Casein kinase II subunit beta Human genes 0.000 description 2
- 101710158100 Casein kinase II subunit beta Proteins 0.000 description 2
- 108050001186 Chaperonin Cpn60 Proteins 0.000 description 2
- 102000052603 Chaperonins Human genes 0.000 description 2
- 102100038423 Claudin-3 Human genes 0.000 description 2
- 108090000599 Claudin-3 Proteins 0.000 description 2
- 102100026098 Claudin-7 Human genes 0.000 description 2
- 102100032648 Copine-3 Human genes 0.000 description 2
- 102000036364 Cullin Ring E3 Ligases Human genes 0.000 description 2
- 108091007045 Cullin Ring E3 Ligases Proteins 0.000 description 2
- 108010058546 Cyclin D1 Proteins 0.000 description 2
- 102100037912 Cyclin-dependent kinase 11A Human genes 0.000 description 2
- WVLZTXGTNGHPBO-SRVKXCTJSA-N Cys-Leu-Leu Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O WVLZTXGTNGHPBO-SRVKXCTJSA-N 0.000 description 2
- XXDATQFUGMAJRV-XIRDDKMYSA-N Cys-Leu-Trp Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(O)=O XXDATQFUGMAJRV-XIRDDKMYSA-N 0.000 description 2
- 108010015742 Cytochrome P-450 Enzyme System Proteins 0.000 description 2
- 102000003849 Cytochrome P450 Human genes 0.000 description 2
- 102100023949 Cytochrome c oxidase subunit NDUFA4 Human genes 0.000 description 2
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 2
- 238000000018 DNA microarray Methods 0.000 description 2
- 102100025535 Delta(14)-sterol reductase TM7SF2 Human genes 0.000 description 2
- 101800001224 Disintegrin Proteins 0.000 description 2
- 102100029721 DnaJ homolog subfamily B member 1 Human genes 0.000 description 2
- 101150080661 Ear1 gene Proteins 0.000 description 2
- 102100027262 Electron transfer flavoprotein subunit beta Human genes 0.000 description 2
- 102100021957 Endonuclease domain-containing 1 protein Human genes 0.000 description 2
- 108090000385 Fibroblast growth factor 7 Proteins 0.000 description 2
- 102100028071 Fibroblast growth factor 7 Human genes 0.000 description 2
- 108091006027 G proteins Proteins 0.000 description 2
- 101710169327 G-rich sequence factor 1 Proteins 0.000 description 2
- 108700012941 GNRH1 Proteins 0.000 description 2
- 108090001072 Gastricsin Proteins 0.000 description 2
- 206010064571 Gene mutation Diseases 0.000 description 2
- GLEGHWQNGPMKHO-DCAQKATOSA-N Gln-His-Glu Chemical compound C1=C(NC=N1)C[C@@H](C(=O)N[C@@H](CCC(=O)O)C(=O)O)NC(=O)[C@H](CCC(=O)N)N GLEGHWQNGPMKHO-DCAQKATOSA-N 0.000 description 2
- RGAOLBZBLOJUTP-GRLWGSQLSA-N Gln-Ile-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)O)NC(=O)[C@H](CCC(=O)N)N RGAOLBZBLOJUTP-GRLWGSQLSA-N 0.000 description 2
- XHWLNISLUFEWNS-CIUDSAMLSA-N Glu-Gln-Gln Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(O)=O XHWLNISLUFEWNS-CIUDSAMLSA-N 0.000 description 2
- DCBSZJJHOTXMHY-DCAQKATOSA-N Glu-Pro-Pro Chemical compound OC(=O)CC[C@H](N)C(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 DCBSZJJHOTXMHY-DCAQKATOSA-N 0.000 description 2
- 108010070600 Glucose-6-phosphate isomerase Proteins 0.000 description 2
- 102000005731 Glucose-6-phosphate isomerase Human genes 0.000 description 2
- 239000000579 Gonadotropin-Releasing Hormone Substances 0.000 description 2
- 102100040754 Guanylate cyclase soluble subunit alpha-1 Human genes 0.000 description 2
- 108010042283 HSP40 Heat-Shock Proteins Proteins 0.000 description 2
- 101000712357 Homo sapiens 60S acidic ribosomal protein P1 Proteins 0.000 description 2
- 101000730830 Homo sapiens ATP-dependent 6-phosphofructokinase, liver type Proteins 0.000 description 2
- 101000757457 Homo sapiens Anaphase-promoting complex subunit 5 Proteins 0.000 description 2
- 101000775732 Homo sapiens Androgen receptor Proteins 0.000 description 2
- 101000792835 Homo sapiens Arginase-2, mitochondrial Proteins 0.000 description 2
- 101000740067 Homo sapiens Barrier-to-autointegration factor Proteins 0.000 description 2
- 101000971617 Homo sapiens Calcium/calmodulin-dependent protein kinase kinase 2 Proteins 0.000 description 2
- 101000941769 Homo sapiens Copine-3 Proteins 0.000 description 2
- 101000738403 Homo sapiens Cyclin-dependent kinase 11A Proteins 0.000 description 2
- 101001111225 Homo sapiens Cytochrome c oxidase subunit NDUFA4 Proteins 0.000 description 2
- 101001056901 Homo sapiens Delta(14)-sterol reductase TM7SF2 Proteins 0.000 description 2
- 101000929877 Homo sapiens Delta(24)-sterol reductase Proteins 0.000 description 2
- 101001057122 Homo sapiens Electron transfer flavoprotein subunit beta Proteins 0.000 description 2
- 101000897352 Homo sapiens Endonuclease domain-containing 1 protein Proteins 0.000 description 2
- 101001006302 Homo sapiens HMG domain-containing protein 3 Proteins 0.000 description 2
- 101001080298 Homo sapiens Heat shock factor-binding protein 1 Proteins 0.000 description 2
- 101001041145 Homo sapiens Homeobox protein Hox-B13 Proteins 0.000 description 2
- 101000599951 Homo sapiens Insulin-like growth factor I Proteins 0.000 description 2
- 101000605028 Homo sapiens Large neutral amino acids transporter small subunit 3 Proteins 0.000 description 2
- 101000962131 Homo sapiens Mediator of RNA polymerase II transcription subunit 1 Proteins 0.000 description 2
- 101001019104 Homo sapiens Mediator of RNA polymerase II transcription subunit 14 Proteins 0.000 description 2
- 101000575066 Homo sapiens Mediator of RNA polymerase II transcription subunit 17 Proteins 0.000 description 2
- 101001095088 Homo sapiens Melanoma antigen preferentially expressed in tumors Proteins 0.000 description 2
- 101001005722 Homo sapiens Melanoma-associated antigen 6 Proteins 0.000 description 2
- 101000961414 Homo sapiens Membrane cofactor protein Proteins 0.000 description 2
- 101001018298 Homo sapiens Microtubule-associated serine/threonine-protein kinase 4 Proteins 0.000 description 2
- 101001111265 Homo sapiens NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 Proteins 0.000 description 2
- 101000604411 Homo sapiens NADH-ubiquinone oxidoreductase chain 1 Proteins 0.000 description 2
- 101000578351 Homo sapiens Nodal modulator 1 Proteins 0.000 description 2
- 101000602930 Homo sapiens Nuclear receptor coactivator 2 Proteins 0.000 description 2
- 101000974343 Homo sapiens Nuclear receptor coactivator 4 Proteins 0.000 description 2
- 101001008429 Homo sapiens Nucleobindin-2 Proteins 0.000 description 2
- 101000600189 Homo sapiens Peroxisomal membrane protein PEX16 Proteins 0.000 description 2
- 101001133656 Homo sapiens Plasminogen activator inhibitor 1 RNA-binding protein Proteins 0.000 description 2
- 101001087352 Homo sapiens Poly(U)-binding-splicing factor PUF60 Proteins 0.000 description 2
- 101001133624 Homo sapiens Polyadenylate-binding protein-interacting protein 1 Proteins 0.000 description 2
- 101001038300 Homo sapiens Protein ERGIC-53 Proteins 0.000 description 2
- 101000668336 Homo sapiens RNA-binding motif protein, X-linked 2 Proteins 0.000 description 2
- 101000873502 Homo sapiens S-adenosylmethionine decarboxylase proenzyme Proteins 0.000 description 2
- 101000867039 Homo sapiens SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related Proteins 0.000 description 2
- 101000713459 Homo sapiens Small nuclear ribonucleoprotein G Proteins 0.000 description 2
- 101000807991 Homo sapiens Testis-specific basic protein Y 1 Proteins 0.000 description 2
- 101000753286 Homo sapiens Transcription intermediary factor 1-beta Proteins 0.000 description 2
- 101000680096 Homo sapiens Transmembrane emp24 domain-containing protein 1 Proteins 0.000 description 2
- 101000638154 Homo sapiens Transmembrane protease serine 2 Proteins 0.000 description 2
- 101100057058 Homo sapiens WDR83OS gene Proteins 0.000 description 2
- 241000701109 Human adenovirus 2 Species 0.000 description 2
- RGSOCXHDOPQREB-ZPFDUUQYSA-N Ile-Asp-Leu Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CC(=O)O)C(=O)N[C@@H](CC(C)C)C(=O)O)N RGSOCXHDOPQREB-ZPFDUUQYSA-N 0.000 description 2
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 2
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 2
- 102100025891 Inosine-5'-monophosphate dehydrogenase 2 Human genes 0.000 description 2
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- 108010044467 Isoenzymes Proteins 0.000 description 2
- 101150045458 KEX2 gene Proteins 0.000 description 2
- AHLPHDHHMVZTML-BYPYZUCNSA-N L-Ornithine Chemical compound NCCC[C@H](N)C(O)=O AHLPHDHHMVZTML-BYPYZUCNSA-N 0.000 description 2
- 102100038269 Large neutral amino acids transporter small subunit 3 Human genes 0.000 description 2
- LOLUPZNNADDTAA-AVGNSLFASA-N Leu-Gln-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O LOLUPZNNADDTAA-AVGNSLFASA-N 0.000 description 2
- 201000011062 Li-Fraumeni syndrome Diseases 0.000 description 2
- 102000003960 Ligases Human genes 0.000 description 2
- 108090000364 Ligases Proteins 0.000 description 2
- NPBGTPKLVJEOBE-IUCAKERBSA-N Lys-Arg Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CCCNC(N)=N NPBGTPKLVJEOBE-IUCAKERBSA-N 0.000 description 2
- UETQMSASAVBGJY-QWRGUYRKSA-N Lys-Gly-His Chemical compound NCCCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CNC=N1 UETQMSASAVBGJY-QWRGUYRKSA-N 0.000 description 2
- NVGBPTNZLWRQSY-UWVGGRQHSA-N Lys-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@H](C(O)=O)CCCCN NVGBPTNZLWRQSY-UWVGGRQHSA-N 0.000 description 2
- 108010062495 Mediator Complex Subunit 1 Proteins 0.000 description 2
- 102000010904 Mediator Complex Subunit 1 Human genes 0.000 description 2
- 102100039204 Mediator of RNA polymerase II transcription subunit 1 Human genes 0.000 description 2
- 102100030253 Mediator of RNA polymerase II transcription subunit 16 Human genes 0.000 description 2
- 101710179286 Mediator of RNA polymerase II transcription subunit 16 Proteins 0.000 description 2
- 102100034821 Mediator of RNA polymerase II transcription subunit 24 Human genes 0.000 description 2
- 102100037020 Melanoma antigen preferentially expressed in tumors Human genes 0.000 description 2
- 102000005741 Metalloproteases Human genes 0.000 description 2
- 108010006035 Metalloproteases Proteins 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 108060004795 Methyltransferase Proteins 0.000 description 2
- 241000699660 Mus musculus Species 0.000 description 2
- 101100348669 Mus musculus Nkx3-1 gene Proteins 0.000 description 2
- 101100296126 Mus musculus Trp53i11 gene Proteins 0.000 description 2
- 102100024021 NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10 Human genes 0.000 description 2
- 102100038625 NADH-ubiquinone oxidoreductase chain 1 Human genes 0.000 description 2
- 101150081376 NR1D1 gene Proteins 0.000 description 2
- 102100027968 Nodal modulator 1 Human genes 0.000 description 2
- 102000007999 Nuclear Proteins Human genes 0.000 description 2
- 108010089610 Nuclear Proteins Proteins 0.000 description 2
- 102100037226 Nuclear receptor coactivator 2 Human genes 0.000 description 2
- 102100022883 Nuclear receptor coactivator 3 Human genes 0.000 description 2
- 102100022927 Nuclear receptor coactivator 4 Human genes 0.000 description 2
- 102100022935 Nuclear receptor corepressor 1 Human genes 0.000 description 2
- 101710153661 Nuclear receptor corepressor 1 Proteins 0.000 description 2
- 102100030569 Nuclear receptor corepressor 2 Human genes 0.000 description 2
- 101710153660 Nuclear receptor corepressor 2 Proteins 0.000 description 2
- 102100022389 Nucleosome assembly protein 1-like 1 Human genes 0.000 description 2
- 101710192961 Nucleosome assembly protein 1-like 1 Proteins 0.000 description 2
- 101710147982 Nucleosome assembly protein 1;1 Proteins 0.000 description 2
- 102000043276 Oncogene Human genes 0.000 description 2
- AHLPHDHHMVZTML-UHFFFAOYSA-N Orn-delta-NH2 Natural products NCCCC(N)C(O)=O AHLPHDHHMVZTML-UHFFFAOYSA-N 0.000 description 2
- UTJLXEIPEHZYQJ-UHFFFAOYSA-N Ornithine Natural products OC(=O)C(C)CCCN UTJLXEIPEHZYQJ-UHFFFAOYSA-N 0.000 description 2
- 102100023240 P antigen family member 4 Human genes 0.000 description 2
- 102000034255 Pepsinogen C Human genes 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 108091005804 Peptidases Proteins 0.000 description 2
- 102000010292 Peptide Elongation Factor 1 Human genes 0.000 description 2
- 108010077524 Peptide Elongation Factor 1 Proteins 0.000 description 2
- 108010068204 Peptide Elongation Factors Proteins 0.000 description 2
- 102000002508 Peptide Elongation Factors Human genes 0.000 description 2
- 108010044843 Peptide Initiation Factors Proteins 0.000 description 2
- 102000005877 Peptide Initiation Factors Human genes 0.000 description 2
- 102000000447 Peptide-N4-(N-acetyl-beta-glucosaminyl) Asparagine Amidase Human genes 0.000 description 2
- 108010055817 Peptide-N4-(N-acetyl-beta-glucosaminyl) Asparagine Amidase Proteins 0.000 description 2
- AJOKKVTWEMXZHC-DRZSPHRISA-N Phe-Ala-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC1=CC=CC=C1 AJOKKVTWEMXZHC-DRZSPHRISA-N 0.000 description 2
- 102000012288 Phosphopyruvate Hydratase Human genes 0.000 description 2
- 108010022181 Phosphopyruvate Hydratase Proteins 0.000 description 2
- SBVPYBFMIGDIDX-SRVKXCTJSA-N Pro-Pro-Pro Chemical compound OC(=O)[C@@H]1CCCN1C(=O)[C@H]1N(C(=O)[C@H]2NCCC2)CCC1 SBVPYBFMIGDIDX-SRVKXCTJSA-N 0.000 description 2
- FDMKYQQYJKYCLV-GUBZILKMSA-N Pro-Pro-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 FDMKYQQYJKYCLV-GUBZILKMSA-N 0.000 description 2
- RCYUBVHMVUHEBM-RCWTZXSCSA-N Pro-Pro-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(O)=O RCYUBVHMVUHEBM-RCWTZXSCSA-N 0.000 description 2
- BVRBCQBUNGAWFP-KKUMJFAQSA-N Pro-Tyr-Gln Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CC2=CC=C(C=C2)O)C(=O)N[C@@H](CCC(=O)N)C(=O)O BVRBCQBUNGAWFP-KKUMJFAQSA-N 0.000 description 2
- 102100026126 Proline-tRNA ligase Human genes 0.000 description 2
- 208000004403 Prostatic Hyperplasia Diseases 0.000 description 2
- 208000004965 Prostatic Intraepithelial Neoplasia Diseases 0.000 description 2
- 206010071019 Prostatic dysplasia Diseases 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 102100040252 Protein ERGIC-53 Human genes 0.000 description 2
- 102000052575 Proto-Oncogene Human genes 0.000 description 2
- 108700020978 Proto-Oncogene Proteins 0.000 description 2
- 101710101078 Proton-activated chloride channel Proteins 0.000 description 2
- 102000004389 Ribonucleoproteins Human genes 0.000 description 2
- 108010081734 Ribonucleoproteins Proteins 0.000 description 2
- 101150058731 STAT5A gene Proteins 0.000 description 2
- 102100031482 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily E member 1-related Human genes 0.000 description 2
- FIXILCYTSAUERA-FXQIFTODSA-N Ser-Ala-Arg Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O FIXILCYTSAUERA-FXQIFTODSA-N 0.000 description 2
- RDFQNDHEHVSONI-ZLUOBGJFSA-N Ser-Asn-Ser Chemical compound OC[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CO)C(O)=O RDFQNDHEHVSONI-ZLUOBGJFSA-N 0.000 description 2
- WEQAYODCJHZSJZ-KKUMJFAQSA-N Ser-His-Tyr Chemical compound C([C@H](NC(=O)[C@H](CO)N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)C1=CN=CN1 WEQAYODCJHZSJZ-KKUMJFAQSA-N 0.000 description 2
- YUJLIIRMIAGMCQ-CIUDSAMLSA-N Ser-Leu-Ser Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O YUJLIIRMIAGMCQ-CIUDSAMLSA-N 0.000 description 2
- 102100024481 Signal transducer and activator of transcription 5A Human genes 0.000 description 2
- 102000004598 Small Nuclear Ribonucleoproteins Human genes 0.000 description 2
- 108010003165 Small Nuclear Ribonucleoproteins Proteins 0.000 description 2
- 102100029809 Small nuclear ribonucleoprotein E Human genes 0.000 description 2
- 101710177718 Transcription intermediary factor 1-beta Proteins 0.000 description 2
- 102000004357 Transferases Human genes 0.000 description 2
- 108090000992 Transferases Proteins 0.000 description 2
- 102100031989 Transmembrane protease serine 2 Human genes 0.000 description 2
- 108010035075 Tyrosine decarboxylase Proteins 0.000 description 2
- 102100038467 Ubiquitin-conjugating enzyme E2 variant 1 Human genes 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- APQIVBCUIUDSMB-OSUNSFLBSA-N Val-Ile-Thr Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H]([C@@H](C)O)C(=O)O)NC(=O)[C@H](C(C)C)N APQIVBCUIUDSMB-OSUNSFLBSA-N 0.000 description 2
- MJFSRZZJQWZHFQ-SRVKXCTJSA-N Val-Met-Val Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](C(C)C)C(=O)O)N MJFSRZZJQWZHFQ-SRVKXCTJSA-N 0.000 description 2
- 108010031770 Vesicular Transport Adaptor Proteins Proteins 0.000 description 2
- 102000005456 Vesicular Transport Adaptor Proteins Human genes 0.000 description 2
- MZVQCMJNVPIDEA-UHFFFAOYSA-N [CH2]CN(CC)CC Chemical group [CH2]CN(CC)CC MZVQCMJNVPIDEA-UHFFFAOYSA-N 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 208000021841 acute erythroid leukemia Diseases 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 125000001931 aliphatic group Chemical group 0.000 description 2
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 2
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 2
- 102000001307 androgen receptors Human genes 0.000 description 2
- 230000002280 anti-androgenic effect Effects 0.000 description 2
- 230000003466 anti-cipated effect Effects 0.000 description 2
- 239000000051 antiandrogen Substances 0.000 description 2
- 108010001271 arginyl-glutamyl-arginine Proteins 0.000 description 2
- 108010062796 arginyllysine Proteins 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 230000003190 augmentative effect Effects 0.000 description 2
- 210000003719 b-lymphocyte Anatomy 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 238000009534 blood test Methods 0.000 description 2
- 238000010804 cDNA synthesis Methods 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- 230000036952 cancer formation Effects 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 230000003197 catalytic effect Effects 0.000 description 2
- 150000001768 cations Chemical class 0.000 description 2
- 230000022131 cell cycle Effects 0.000 description 2
- 230000030833 cell death Effects 0.000 description 2
- 239000003610 charcoal Substances 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- 239000013599 cloning vector Substances 0.000 description 2
- 210000003477 cochlea Anatomy 0.000 description 2
- 210000001072 colon Anatomy 0.000 description 2
- 230000000052 comparative effect Effects 0.000 description 2
- 238000004590 computer program Methods 0.000 description 2
- 108010039581 copine III Proteins 0.000 description 2
- 108010060199 cysteinylproline Proteins 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 230000007547 defect Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 229960000633 dextran sulfate Drugs 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 108010079167 dihydrolipoamide succinyltransferase Proteins 0.000 description 2
- SLPJGDQJLTYWCI-UHFFFAOYSA-N dimethyl-(4,5,6,7-tetrabromo-1h-benzoimidazol-2-yl)-amine Chemical compound BrC1=C(Br)C(Br)=C2NC(N(C)C)=NC2=C1Br SLPJGDQJLTYWCI-UHFFFAOYSA-N 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- 230000003828 downregulation Effects 0.000 description 2
- 108700002148 exportin 1 Proteins 0.000 description 2
- 230000002538 fungal effect Effects 0.000 description 2
- 210000004602 germ cell Anatomy 0.000 description 2
- 108010078144 glutaminyl-glycine Proteins 0.000 description 2
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 2
- 125000003147 glycosyl group Chemical group 0.000 description 2
- VPZXBVLAVMBEQI-UHFFFAOYSA-N glycyl-DL-alpha-alanine Natural products OC(=O)C(C)NC(=O)CN VPZXBVLAVMBEQI-UHFFFAOYSA-N 0.000 description 2
- 108010019832 glycyl-asparaginyl-glycine Proteins 0.000 description 2
- 108010062266 glycyl-glycyl-argininal Proteins 0.000 description 2
- 108010077515 glycylproline Proteins 0.000 description 2
- 108010028295 histidylhistidine Proteins 0.000 description 2
- 108091008039 hormone receptors Proteins 0.000 description 2
- 238000001794 hormone therapy Methods 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- 238000012744 immunostaining Methods 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- 238000007901 in situ hybridization Methods 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 230000000415 inactivating effect Effects 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 2
- 230000002608 insulinlike Effects 0.000 description 2
- 238000011835 investigation Methods 0.000 description 2
- 210000003292 kidney cell Anatomy 0.000 description 2
- 108010073472 leucyl-prolyl-proline Proteins 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 108010054155 lysyllysine Proteins 0.000 description 2
- 238000012423 maintenance Methods 0.000 description 2
- 230000003211 malignant effect Effects 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 2
- 238000002493 microarray Methods 0.000 description 2
- 230000009456 molecular mechanism Effects 0.000 description 2
- 210000002569 neuron Anatomy 0.000 description 2
- 238000011580 nude mouse model Methods 0.000 description 2
- 125000002347 octyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 2
- 238000011474 orchiectomy Methods 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 229960003104 ornithine Drugs 0.000 description 2
- 201000008968 osteosarcoma Diseases 0.000 description 2
- 210000000496 pancreas Anatomy 0.000 description 2
- 210000002824 peroxisome Anatomy 0.000 description 2
- 108010049148 plastin Proteins 0.000 description 2
- 108010004107 poly-U binding splicing factor 60KDa Proteins 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 108010090955 preprorelaxin Proteins 0.000 description 2
- 230000037452 priming Effects 0.000 description 2
- 229960003387 progesterone Drugs 0.000 description 2
- 239000000186 progesterone Substances 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- 201000001514 prostate carcinoma Diseases 0.000 description 2
- 210000000064 prostate epithelial cell Anatomy 0.000 description 2
- 208000021046 prostate intraepithelial neoplasia Diseases 0.000 description 2
- 230000002797 proteolythic effect Effects 0.000 description 2
- 150000003254 radicals Chemical class 0.000 description 2
- 239000003642 reactive oxygen metabolite Substances 0.000 description 2
- 238000003259 recombinant expression Methods 0.000 description 2
- 230000000306 recurrent effect Effects 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 2
- 230000008439 repair process Effects 0.000 description 2
- 239000011347 resin Substances 0.000 description 2
- 229920005989 resin Polymers 0.000 description 2
- 210000001525 retina Anatomy 0.000 description 2
- 238000003757 reverse transcription PCR Methods 0.000 description 2
- 210000003705 ribosome Anatomy 0.000 description 2
- 235000019515 salmon Nutrition 0.000 description 2
- 238000003196 serial analysis of gene expression Methods 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- PFNFFQXMRSDOHW-UHFFFAOYSA-N spermine Chemical compound NCCCNCCCCNCCCN PFNFFQXMRSDOHW-UHFFFAOYSA-N 0.000 description 2
- 210000004989 spleen cell Anatomy 0.000 description 2
- 108010067507 tacrolimus binding protein 5 Proteins 0.000 description 2
- 210000001550 testis Anatomy 0.000 description 2
- 102000004217 thyroid hormone receptors Human genes 0.000 description 2
- 108090000721 thyroid hormone receptors Proteins 0.000 description 2
- 108010084932 tryptophyl-proline Proteins 0.000 description 2
- 210000004881 tumor cell Anatomy 0.000 description 2
- 230000005751 tumor progression Effects 0.000 description 2
- 108010051110 tyrosyl-lysine Proteins 0.000 description 2
- 230000003827 upregulation Effects 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 229940035893 uracil Drugs 0.000 description 2
- 238000011179 visual inspection Methods 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- DIGQNXIGRZPYDK-WKSCXVIASA-N (2R)-6-amino-2-[[2-[[(2S)-2-[[2-[[(2R)-2-[[(2S)-2-[[(2R,3S)-2-[[2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2R)-2-[[(2S,3S)-2-[[(2R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2R)-2-[[2-[[2-[[2-[(2-amino-1-hydroxyethylidene)amino]-3-carboxy-1-hydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1,5-dihydroxy-5-iminopentylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]hexanoic acid Chemical compound C[C@@H]([C@@H](C(=N[C@@H](CS)C(=N[C@@H](C)C(=N[C@@H](CO)C(=NCC(=N[C@@H](CCC(=N)O)C(=NC(CS)C(=N[C@H]([C@H](C)O)C(=N[C@H](CS)C(=N[C@H](CO)C(=NCC(=N[C@H](CS)C(=NCC(=N[C@H](CCCCN)C(=O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)N=C([C@H](CS)N=C([C@H](CO)N=C([C@H](CO)N=C([C@H](C)N=C(CN=C([C@H](CO)N=C([C@H](CS)N=C(CN=C(C(CS)N=C(C(CC(=O)O)N=C(CN)O)O)O)O)O)O)O)O)O)O)O)O DIGQNXIGRZPYDK-WKSCXVIASA-N 0.000 description 1
- CWFMWBHMIMNZLN-NAKRPEOUSA-N (2s)-1-[(2s)-2-[[(2s,3s)-2-amino-3-methylpentanoyl]amino]propanoyl]pyrrolidine-2-carboxylic acid Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(O)=O CWFMWBHMIMNZLN-NAKRPEOUSA-N 0.000 description 1
- AXFMEGAFCUULFV-BLFANLJRSA-N (2s)-2-[[(2s)-1-[(2s,3r)-2-amino-3-methylpentanoyl]pyrrolidine-2-carbonyl]amino]pentanedioic acid Chemical compound CC[C@@H](C)[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O AXFMEGAFCUULFV-BLFANLJRSA-N 0.000 description 1
- AKHONHCNYRUTLT-NXBFSHDWSA-N (8R,9S,10R,13S,14S,17S)-15,15,17-trihydroxy-10,13-dimethyl-2,6,7,8,9,11,12,14,16,17-decahydro-1H-cyclopenta[a]phenanthren-3-one Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4(O)O)O)[C@@H]4[C@@H]3CCC2=C1 AKHONHCNYRUTLT-NXBFSHDWSA-N 0.000 description 1
- PORPENFLTBBHSG-MGBGTMOVSA-N 1,2-dihexadecanoyl-sn-glycerol-3-phosphate Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(O)=O)OC(=O)CCCCCCCCCCCCCCC PORPENFLTBBHSG-MGBGTMOVSA-N 0.000 description 1
- 108010020567 12E7 Antigen Proteins 0.000 description 1
- 102000008482 12E7 Antigen Human genes 0.000 description 1
- VWFJDQUYCIWHTN-YFVJMOTDSA-N 2-trans,6-trans-farnesyl diphosphate Chemical compound CC(C)=CCC\C(C)=C\CC\C(C)=C\CO[P@](O)(=O)OP(O)(O)=O VWFJDQUYCIWHTN-YFVJMOTDSA-N 0.000 description 1
- 102100036563 26S proteasome regulatory subunit 8 Human genes 0.000 description 1
- 102100039082 3 beta-hydroxysteroid dehydrogenase/Delta 5->4-isomerase type 1 Human genes 0.000 description 1
- 102100029077 3-hydroxy-3-methylglutaryl-coenzyme A reductase Human genes 0.000 description 1
- 101710158485 3-hydroxy-3-methylglutaryl-coenzyme A reductase Proteins 0.000 description 1
- 102100034254 3-oxo-5-alpha-steroid 4-dehydrogenase 1 Human genes 0.000 description 1
- QRXMUCSWCMTJGU-UHFFFAOYSA-N 5-bromo-4-chloro-3-indolyl phosphate Chemical compound C1=C(Br)C(Cl)=C2C(OP(O)(=O)O)=CNC2=C1 QRXMUCSWCMTJGU-UHFFFAOYSA-N 0.000 description 1
- 102100033416 60S acidic ribosomal protein P1 Human genes 0.000 description 1
- 102100024442 60S ribosomal protein L13 Human genes 0.000 description 1
- 102100021690 60S ribosomal protein L18a Human genes 0.000 description 1
- 102100036630 60S ribosomal protein L7a Human genes 0.000 description 1
- 108010071550 ATP-Dependent Proteases Proteins 0.000 description 1
- 102000007566 ATP-Dependent Proteases Human genes 0.000 description 1
- 102100033350 ATP-dependent translocase ABCB1 Human genes 0.000 description 1
- 102100039164 Acetyl-CoA carboxylase 1 Human genes 0.000 description 1
- 101710159080 Aconitate hydratase A Proteins 0.000 description 1
- 101710159078 Aconitate hydratase B Proteins 0.000 description 1
- HRPVXLWXLXDGHG-UHFFFAOYSA-N Acrylamide Chemical compound NC(=O)C=C HRPVXLWXLXDGHG-UHFFFAOYSA-N 0.000 description 1
- 102000004365 Actin Capping Proteins Human genes 0.000 description 1
- 108010017189 Actin Capping Proteins Proteins 0.000 description 1
- 102100022089 Acyl-[acyl-carrier-protein] hydrolase Human genes 0.000 description 1
- 229930024421 Adenine Natural products 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 102100030446 Adenosine 5'-monophosphoramidase HINT1 Human genes 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- TTXMOJWKNRJWQJ-FXQIFTODSA-N Ala-Arg-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CCCN=C(N)N TTXMOJWKNRJWQJ-FXQIFTODSA-N 0.000 description 1
- PUBLUECXJRHTBK-ACZMJKKPSA-N Ala-Glu-Ser Chemical compound C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O PUBLUECXJRHTBK-ACZMJKKPSA-N 0.000 description 1
- ZPXCNXMJEZKRLU-LSJOCFKGSA-N Ala-His-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)C)CC1=CN=CN1 ZPXCNXMJEZKRLU-LSJOCFKGSA-N 0.000 description 1
- SOBIAADAMRHGKH-CIUDSAMLSA-N Ala-Leu-Ser Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O SOBIAADAMRHGKH-CIUDSAMLSA-N 0.000 description 1
- MAZZQZWCCYJQGZ-GUBZILKMSA-N Ala-Pro-Arg Chemical compound [H]N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCNC(N)=N)C(O)=O MAZZQZWCCYJQGZ-GUBZILKMSA-N 0.000 description 1
- ADSGHMXEAZJJNF-DCAQKATOSA-N Ala-Pro-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H](C)N ADSGHMXEAZJJNF-DCAQKATOSA-N 0.000 description 1
- MSWSRLGNLKHDEI-ACZMJKKPSA-N Ala-Ser-Glu Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O MSWSRLGNLKHDEI-ACZMJKKPSA-N 0.000 description 1
- PEEYDECOOVQKRZ-DLOVCJGASA-N Ala-Ser-Phe Chemical compound [H]N[C@@H](C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O PEEYDECOOVQKRZ-DLOVCJGASA-N 0.000 description 1
- QKHWNPQNOHEFST-VZFHVOOUSA-N Ala-Thr-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](C)N)O QKHWNPQNOHEFST-VZFHVOOUSA-N 0.000 description 1
- 102100039075 Aldehyde dehydrogenase family 1 member A3 Human genes 0.000 description 1
- 101710192173 Aldehyde dehydrogenase family 1 member A3 Proteins 0.000 description 1
- 102100021266 Alpha-(1,6)-fucosyltransferase Human genes 0.000 description 1
- 102100022463 Alpha-1-acid glycoprotein 1 Human genes 0.000 description 1
- 101710186701 Alpha-1-acid glycoprotein 1 Proteins 0.000 description 1
- 102100022524 Alpha-1-antichymotrypsin Human genes 0.000 description 1
- 101710185917 Amine oxidase [flavin-containing] A Proteins 0.000 description 1
- 102100028661 Amine oxidase [flavin-containing] A Human genes 0.000 description 1
- 102000052588 Anaphase-Promoting Complex-Cyclosome Apc5 Subunit Human genes 0.000 description 1
- 208000009575 Angelman syndrome Diseases 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 101100346430 Arabidopsis thaliana MRF2 gene Proteins 0.000 description 1
- 102000009515 Arachidonate 15-Lipoxygenase Human genes 0.000 description 1
- 108010048907 Arachidonate 15-lipoxygenase Proteins 0.000 description 1
- OMLWNBVRVJYMBQ-YUMQZZPRSA-N Arg-Arg Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O OMLWNBVRVJYMBQ-YUMQZZPRSA-N 0.000 description 1
- XPSGESXVBSQZPL-SRVKXCTJSA-N Arg-Arg-Arg Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](CCCN=C(N)N)C(O)=O XPSGESXVBSQZPL-SRVKXCTJSA-N 0.000 description 1
- UFBURHXMKFQVLM-CIUDSAMLSA-N Arg-Glu-Ser Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O UFBURHXMKFQVLM-CIUDSAMLSA-N 0.000 description 1
- CRCCTGPNZUCAHE-DCAQKATOSA-N Arg-His-Ser Chemical compound NC(N)=NCCC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](CO)C(O)=O)CC1=CN=CN1 CRCCTGPNZUCAHE-DCAQKATOSA-N 0.000 description 1
- WMEVEPXNCMKNGH-IHRRRGAJSA-N Arg-Leu-His Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CCCN=C(N)N)N WMEVEPXNCMKNGH-IHRRRGAJSA-N 0.000 description 1
- VIINVRPKMUZYOI-DCAQKATOSA-N Arg-Met-Glu Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCC(O)=O)C(O)=O VIINVRPKMUZYOI-DCAQKATOSA-N 0.000 description 1
- VEAIMHJZTIDCIH-KKUMJFAQSA-N Arg-Phe-Gln Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CCC(N)=O)C(O)=O VEAIMHJZTIDCIH-KKUMJFAQSA-N 0.000 description 1
- HNJNAMGZQZPSRE-GUBZILKMSA-N Arg-Pro-Asn Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(N)=O)C(O)=O HNJNAMGZQZPSRE-GUBZILKMSA-N 0.000 description 1
- AMIQZQAAYGYKOP-FXQIFTODSA-N Arg-Ser-Asn Chemical compound [H]N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O AMIQZQAAYGYKOP-FXQIFTODSA-N 0.000 description 1
- 102100030356 Arginase-2, mitochondrial Human genes 0.000 description 1
- 208000002109 Argyria Diseases 0.000 description 1
- 108090000121 Aromatic-L-amino-acid decarboxylases Proteins 0.000 description 1
- 102000003823 Aromatic-L-amino-acid decarboxylases Human genes 0.000 description 1
- 102000009133 Arylsulfatases Human genes 0.000 description 1
- 101001120734 Ascaris suum Pyruvate dehydrogenase E1 component subunit alpha type I, mitochondrial Proteins 0.000 description 1
- BDMIFVIWCNLDCT-CIUDSAMLSA-N Asn-Arg-Glu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(O)=O BDMIFVIWCNLDCT-CIUDSAMLSA-N 0.000 description 1
- PBVLJOIPOGUQQP-CIUDSAMLSA-N Asp-Ala-Leu Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(O)=O PBVLJOIPOGUQQP-CIUDSAMLSA-N 0.000 description 1
- IXIWEFWRKIUMQX-DCAQKATOSA-N Asp-Arg-Leu Chemical compound CC(C)C[C@@H](C(O)=O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@@H](N)CC(O)=O IXIWEFWRKIUMQX-DCAQKATOSA-N 0.000 description 1
- MRQQMVZUHXUPEV-IHRRRGAJSA-N Asp-Arg-Phe Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O MRQQMVZUHXUPEV-IHRRRGAJSA-N 0.000 description 1
- IVPNEDNYYYFAGI-GARJFASQSA-N Asp-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC(=O)O)N IVPNEDNYYYFAGI-GARJFASQSA-N 0.000 description 1
- QNIACYURSSCLRP-GUBZILKMSA-N Asp-Lys-Gln Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(N)=O)C(O)=O QNIACYURSSCLRP-GUBZILKMSA-N 0.000 description 1
- AHWRSSLYSGLBGD-CIUDSAMLSA-N Asp-Pro-Glu Chemical compound OC(=O)C[C@H](N)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCC(O)=O)C(O)=O AHWRSSLYSGLBGD-CIUDSAMLSA-N 0.000 description 1
- 208000003950 B-cell lymphoma Diseases 0.000 description 1
- 108700034663 BCL2-associated athanogene 1 Proteins 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- 101710118343 Barrier-to-autointegration factor Proteins 0.000 description 1
- 102100023973 Bax inhibitor 1 Human genes 0.000 description 1
- 102100032487 Beta-mannosidase Human genes 0.000 description 1
- 102100025142 Beta-microseminoprotein Human genes 0.000 description 1
- 108010049870 Bone Morphogenetic Protein 7 Proteins 0.000 description 1
- 102100022544 Bone morphogenetic protein 7 Human genes 0.000 description 1
- 102000000169 Bradykinin receptor B1 Human genes 0.000 description 1
- 108050008513 Bradykinin receptor B1 Proteins 0.000 description 1
- 102100027157 Butyrophilin subfamily 2 member A1 Human genes 0.000 description 1
- 108010017533 Butyrophilins Proteins 0.000 description 1
- 102000004555 Butyrophilins Human genes 0.000 description 1
- 108010053652 Butyrylcholinesterase Proteins 0.000 description 1
- 101710133654 C-5 sterol desaturase Proteins 0.000 description 1
- 102100036841 C-C motif chemokine 1 Human genes 0.000 description 1
- 101710155835 C-C motif chemokine 1 Proteins 0.000 description 1
- 102100021390 C-terminal-binding protein 1 Human genes 0.000 description 1
- 101710178052 C-terminal-binding protein 1 Proteins 0.000 description 1
- 101150042405 CCN1 gene Proteins 0.000 description 1
- 108010062802 CD66 antigens Proteins 0.000 description 1
- 101150012716 CDK1 gene Proteins 0.000 description 1
- 102000056162 CELF1 Human genes 0.000 description 1
- 108700015925 CELF1 Proteins 0.000 description 1
- 102100027098 CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 Human genes 0.000 description 1
- 108010065376 COUP Transcription Factor I Proteins 0.000 description 1
- 108010020650 COUP Transcription Factor II Proteins 0.000 description 1
- 102100021975 CREB-binding protein Human genes 0.000 description 1
- 102000000905 Cadherin Human genes 0.000 description 1
- 108050007957 Cadherin Proteins 0.000 description 1
- 101100042630 Caenorhabditis elegans sin-3 gene Proteins 0.000 description 1
- 102000004631 Calcineurin Human genes 0.000 description 1
- 108010042955 Calcineurin Proteins 0.000 description 1
- 108010026870 Calcium-Calmodulin-Dependent Protein Kinases Proteins 0.000 description 1
- 102000019025 Calcium-Calmodulin-Dependent Protein Kinases Human genes 0.000 description 1
- 241000189662 Calla Species 0.000 description 1
- 102100029968 Calreticulin Human genes 0.000 description 1
- 108090000549 Calreticulin Proteins 0.000 description 1
- 102000019198 CapZ Actin Capping Protein Human genes 0.000 description 1
- 108010012892 CapZ Actin Capping Protein Proteins 0.000 description 1
- 108090000489 Carboxy-Lyases Proteins 0.000 description 1
- 102000004031 Carboxy-Lyases Human genes 0.000 description 1
- 201000009030 Carcinoma Diseases 0.000 description 1
- 102000002666 Carnitine O-palmitoyltransferase Human genes 0.000 description 1
- 108010018424 Carnitine O-palmitoyltransferase Proteins 0.000 description 1
- 102000009193 Caveolin Human genes 0.000 description 1
- 108050000084 Caveolin Proteins 0.000 description 1
- 206010057248 Cell death Diseases 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 102000016078 Chaperonin Containing TCP-1 Human genes 0.000 description 1
- 108010010706 Chaperonin Containing TCP-1 Proteins 0.000 description 1
- 241000282552 Chlorocebus aethiops Species 0.000 description 1
- 108010066551 Cholestenone 5 alpha-Reductase Proteins 0.000 description 1
- 102100032404 Cholinesterase Human genes 0.000 description 1
- 102000017589 Chromo domains Human genes 0.000 description 1
- 108050005811 Chromo domains Proteins 0.000 description 1
- 101710170308 Chromodomain-helicase-DNA-binding protein 4 Proteins 0.000 description 1
- 206010008805 Chromosomal abnormalities Diseases 0.000 description 1
- 208000031404 Chromosome Aberrations Diseases 0.000 description 1
- 102100032559 Clathrin light chain B Human genes 0.000 description 1
- 101710093540 Clathrin light chain B Proteins 0.000 description 1
- 108050007296 Claudin-7 Proteins 0.000 description 1
- 102100033538 Clusterin-associated protein 1 Human genes 0.000 description 1
- 101100007328 Cocos nucifera COS-1 gene Proteins 0.000 description 1
- 206010009944 Colon cancer Diseases 0.000 description 1
- 238000011537 Coomassie blue staining Methods 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 102000005636 Cyclic AMP Response Element-Binding Protein Human genes 0.000 description 1
- 108010045171 Cyclic AMP Response Element-Binding Protein Proteins 0.000 description 1
- 102000008130 Cyclic AMP-Dependent Protein Kinases Human genes 0.000 description 1
- 108010058545 Cyclin D3 Proteins 0.000 description 1
- 102000004030 Cyclin G2 Human genes 0.000 description 1
- 108090000487 Cyclin G2 Proteins 0.000 description 1
- 108010024986 Cyclin-Dependent Kinase 2 Proteins 0.000 description 1
- 108010025464 Cyclin-Dependent Kinase 4 Proteins 0.000 description 1
- 108010025468 Cyclin-Dependent Kinase 6 Proteins 0.000 description 1
- 102000000577 Cyclin-Dependent Kinase Inhibitor p27 Human genes 0.000 description 1
- 108010016777 Cyclin-Dependent Kinase Inhibitor p27 Proteins 0.000 description 1
- 102100033144 Cyclin-dependent kinase 18 Human genes 0.000 description 1
- 102100033145 Cyclin-dependent kinase 19 Human genes 0.000 description 1
- 102100036239 Cyclin-dependent kinase 2 Human genes 0.000 description 1
- 102100036252 Cyclin-dependent kinase 4 Human genes 0.000 description 1
- 102100026804 Cyclin-dependent kinase 6 Human genes 0.000 description 1
- 102100024457 Cyclin-dependent kinase 9 Human genes 0.000 description 1
- 102100024458 Cyclin-dependent kinase inhibitor 2A Human genes 0.000 description 1
- 108010048028 Cyclophilin D Proteins 0.000 description 1
- SAEVTQWAYDPXMU-KATARQTJSA-N Cys-Thr-Leu Chemical compound [H]N[C@@H](CS)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(C)C)C(O)=O SAEVTQWAYDPXMU-KATARQTJSA-N 0.000 description 1
- BOMGEMDZTNZESV-QWRGUYRKSA-N Cys-Tyr-Gly Chemical compound SC[C@H](N)C(=O)N[C@H](C(=O)NCC(O)=O)CC1=CC=C(O)C=C1 BOMGEMDZTNZESV-QWRGUYRKSA-N 0.000 description 1
- 101710089502 Cystatin-related protein 1 Proteins 0.000 description 1
- 101710089503 Cystatin-related protein 2 Proteins 0.000 description 1
- 102100027367 Cysteine-rich secretory protein 3 Human genes 0.000 description 1
- 102000000634 Cytochrome c oxidase subunit IV Human genes 0.000 description 1
- 108090000365 Cytochrome-c oxidases Proteins 0.000 description 1
- 102100039868 Cytoplasmic aconitate hydratase Human genes 0.000 description 1
- 101710194502 Cytoplasmic aconitate hydratase Proteins 0.000 description 1
- 108010033333 DEAD-box RNA Helicases Proteins 0.000 description 1
- 102000007120 DEAD-box RNA Helicases Human genes 0.000 description 1
- 230000004544 DNA amplification Effects 0.000 description 1
- 230000033616 DNA repair Effects 0.000 description 1
- 102100033711 DNA replication licensing factor MCM7 Human genes 0.000 description 1
- 238000001712 DNA sequencing Methods 0.000 description 1
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 1
- 101710096438 DNA-binding protein Proteins 0.000 description 1
- 101100016370 Danio rerio hsp90a.1 gene Proteins 0.000 description 1
- 102100035890 Delta(24)-sterol reductase Human genes 0.000 description 1
- 101710111046 Delta(7)-sterol 5(6)-desaturase Proteins 0.000 description 1
- 102100036912 Desmin Human genes 0.000 description 1
- 108010044052 Desmin Proteins 0.000 description 1
- 101100285708 Dictyostelium discoideum hspD gene Proteins 0.000 description 1
- 101100125027 Dictyostelium discoideum mhsp70 gene Proteins 0.000 description 1
- SHIBSTMRCDJXLN-UHFFFAOYSA-N Digoxigenin Natural products C1CC(C2C(C3(C)CCC(O)CC3CC2)CC2O)(O)C2(C)C1C1=CC(=O)OC1 SHIBSTMRCDJXLN-UHFFFAOYSA-N 0.000 description 1
- 108010006731 Dimethylallyltranstransferase Proteins 0.000 description 1
- 108090000204 Dipeptidase 1 Proteins 0.000 description 1
- 102100028572 Disabled homolog 2 Human genes 0.000 description 1
- 101710197163 Disabled homolog 2 Proteins 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 108010006631 Drosophila TBP-related factor Proteins 0.000 description 1
- 241000255601 Drosophila melanogaster Species 0.000 description 1
- 101000761845 Drosophila melanogaster ATP-dependent helicase brm Proteins 0.000 description 1
- 102100024827 Dynamin-1-like protein Human genes 0.000 description 1
- 101710109538 Dynamin-1-like protein Proteins 0.000 description 1
- 102100021238 Dynamin-2 Human genes 0.000 description 1
- 102100035989 E3 SUMO-protein ligase PIAS1 Human genes 0.000 description 1
- 101710191258 E3 SUMO-protein ligase PIAS1 Proteins 0.000 description 1
- 102100036254 E3 SUMO-protein ligase PIAS2 Human genes 0.000 description 1
- 101710191251 E3 SUMO-protein ligase PIAS2 Proteins 0.000 description 1
- 102100030837 E3 SUMO-protein ligase PIAS3 Human genes 0.000 description 1
- 102100030987 E3 SUMO-protein ligase PIAS4 Human genes 0.000 description 1
- 101710191253 E3 SUMO-protein ligase PIAS4 Proteins 0.000 description 1
- 102100022404 E3 ubiquitin-protein ligase Midline-1 Human genes 0.000 description 1
- 102100034189 E3 ubiquitin-protein ligase RNF14 Human genes 0.000 description 1
- 102100021820 E3 ubiquitin-protein ligase RNF4 Human genes 0.000 description 1
- 102100029211 E3 ubiquitin-protein ligase TTC3 Human genes 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 102100030081 EPM2A-interacting protein 1 Human genes 0.000 description 1
- 108010032363 ERRalpha estrogen-related receptor Proteins 0.000 description 1
- 102100039577 ETS translocation variant 5 Human genes 0.000 description 1
- 102100035087 Ectoderm-neural cortex protein 1 Human genes 0.000 description 1
- 108010089760 Electron Transport Complex I Proteins 0.000 description 1
- 102000008013 Electron Transport Complex I Human genes 0.000 description 1
- 102100030695 Electron transfer flavoprotein subunit alpha, mitochondrial Human genes 0.000 description 1
- 108010079426 Electron-Transferring Flavoproteins Proteins 0.000 description 1
- 102000012737 Electron-Transferring Flavoproteins Human genes 0.000 description 1
- 102100030209 Elongin-B Human genes 0.000 description 1
- 101710181478 Envelope glycoprotein GP350 Proteins 0.000 description 1
- 101800003838 Epidermal growth factor Proteins 0.000 description 1
- 102000056372 ErbB-3 Receptor Human genes 0.000 description 1
- 101001065501 Escherichia phage MS2 Lysis protein Proteins 0.000 description 1
- 102100026765 Eukaryotic translation initiation factor 4H Human genes 0.000 description 1
- 102100020987 Eukaryotic translation initiation factor 5 Human genes 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 102100029095 Exportin-1 Human genes 0.000 description 1
- 102100020903 Ezrin Human genes 0.000 description 1
- 108010004078 F1F0-ATP synthase Proteins 0.000 description 1
- 102100027267 FERM, ARHGEF and pleckstrin domain-containing protein 1 Human genes 0.000 description 1
- 108010020195 FLAG peptide Proteins 0.000 description 1
- 102100040553 FXYD domain-containing ion transport regulator 3 Human genes 0.000 description 1
- 101150078182 FXYD3 gene Proteins 0.000 description 1
- 108010054218 Factor VIII Proteins 0.000 description 1
- 102000001690 Factor VIII Human genes 0.000 description 1
- VWFJDQUYCIWHTN-FBXUGWQNSA-N Farnesyl diphosphate Natural products CC(C)=CCC\C(C)=C/CC\C(C)=C/COP(O)(=O)OP(O)(O)=O VWFJDQUYCIWHTN-FBXUGWQNSA-N 0.000 description 1
- 102100035111 Farnesyl pyrophosphate synthase Human genes 0.000 description 1
- 108010039731 Fatty Acid Synthases Proteins 0.000 description 1
- 102100030421 Fatty acid-binding protein 5 Human genes 0.000 description 1
- 102000008857 Ferritin Human genes 0.000 description 1
- 108050000784 Ferritin Proteins 0.000 description 1
- 238000008416 Ferritin Methods 0.000 description 1
- 102100030771 Ferrochelatase, mitochondrial Human genes 0.000 description 1
- 108010069446 Fertilins Proteins 0.000 description 1
- 102000001133 Fertilins Human genes 0.000 description 1
- 102100028412 Fibroblast growth factor 10 Human genes 0.000 description 1
- 102000003972 Fibroblast growth factor 7 Human genes 0.000 description 1
- 108090000368 Fibroblast growth factor 8 Proteins 0.000 description 1
- 102100037680 Fibroblast growth factor 8 Human genes 0.000 description 1
- 102100037362 Fibronectin Human genes 0.000 description 1
- 108010067306 Fibronectins Proteins 0.000 description 1
- 102100024508 Ficolin-1 Human genes 0.000 description 1
- 108090000852 Forkhead Transcription Factors Proteins 0.000 description 1
- 102000004315 Forkhead Transcription Factors Human genes 0.000 description 1
- 102100023374 Forkhead box protein M1 Human genes 0.000 description 1
- 102100036313 Forkhead box protein O3B Human genes 0.000 description 1
- 102100040578 G antigen 7 Human genes 0.000 description 1
- 102000034286 G proteins Human genes 0.000 description 1
- 102100037859 G1/S-specific cyclin-D3 Human genes 0.000 description 1
- 102100037854 G1/S-specific cyclin-E2 Human genes 0.000 description 1
- 102000030782 GTP binding Human genes 0.000 description 1
- 108091000058 GTP-Binding Proteins 0.000 description 1
- 101710113436 GTPase KRas Proteins 0.000 description 1
- 102100039788 GTPase NRas Human genes 0.000 description 1
- 102100039554 Galectin-8 Human genes 0.000 description 1
- 108010046569 Galectins Proteins 0.000 description 1
- 102000007563 Galectins Human genes 0.000 description 1
- 230000010558 Gene Alterations Effects 0.000 description 1
- 102100033840 General transcription factor IIF subunit 1 Human genes 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 206010071602 Genetic polymorphism Diseases 0.000 description 1
- SOBBAYVQSNXYPQ-ACZMJKKPSA-N Gln-Asn-Asn Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(N)=O)C(O)=O SOBBAYVQSNXYPQ-ACZMJKKPSA-N 0.000 description 1
- KVXVVDFOZNYYKZ-DCAQKATOSA-N Gln-Gln-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(O)=O KVXVVDFOZNYYKZ-DCAQKATOSA-N 0.000 description 1
- RBWKVOSARCFSQQ-FXQIFTODSA-N Gln-Gln-Ser Chemical compound NC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(O)=O RBWKVOSARCFSQQ-FXQIFTODSA-N 0.000 description 1
- KCJJFESQRXGTGC-BQBZGAKWSA-N Gln-Glu-Gly Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O KCJJFESQRXGTGC-BQBZGAKWSA-N 0.000 description 1
- IKFZXRLDMYWNBU-YUMQZZPRSA-N Gln-Gly-Arg Chemical compound NC(=O)CC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CCCN=C(N)N IKFZXRLDMYWNBU-YUMQZZPRSA-N 0.000 description 1
- PODFFOWWLUPNMN-DCAQKATOSA-N Gln-His-Gln Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(O)=O PODFFOWWLUPNMN-DCAQKATOSA-N 0.000 description 1
- HWEINOMSWQSJDC-SRVKXCTJSA-N Gln-Leu-Arg Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O HWEINOMSWQSJDC-SRVKXCTJSA-N 0.000 description 1
- SXGMGNZEHFORAV-IUCAKERBSA-N Gln-Lys-Gly Chemical compound C(CCN)C[C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](CCC(=O)N)N SXGMGNZEHFORAV-IUCAKERBSA-N 0.000 description 1
- NYCVMJGIJYQWDO-CIUDSAMLSA-N Gln-Ser-Arg Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O NYCVMJGIJYQWDO-CIUDSAMLSA-N 0.000 description 1
- JILRMFFFCHUUTJ-ACZMJKKPSA-N Gln-Ser-Ser Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O JILRMFFFCHUUTJ-ACZMJKKPSA-N 0.000 description 1
- 102000006395 Globulins Human genes 0.000 description 1
- 108010044091 Globulins Proteins 0.000 description 1
- OPAINBJQDQTGJY-JGVFFNPUSA-N Glu-Gly-Pro Chemical compound C1C[C@@H](N(C1)C(=O)CNC(=O)[C@H](CCC(=O)O)N)C(=O)O OPAINBJQDQTGJY-JGVFFNPUSA-N 0.000 description 1
- HPJLZFTUUJKWAJ-JHEQGTHGSA-N Glu-Gly-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H]([C@@H](C)O)C(O)=O HPJLZFTUUJKWAJ-JHEQGTHGSA-N 0.000 description 1
- VMKCPNBBPGGQBJ-GUBZILKMSA-N Glu-Leu-Asn Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CC(=O)N)C(=O)O)NC(=O)[C@H](CCC(=O)O)N VMKCPNBBPGGQBJ-GUBZILKMSA-N 0.000 description 1
- PMSMKNYRZCKVMC-DRZSPHRISA-N Glu-Phe-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=CC=C1)NC(=O)[C@H](CCC(=O)O)N PMSMKNYRZCKVMC-DRZSPHRISA-N 0.000 description 1
- KXTAGESXNQEZKB-DZKIICNBSA-N Glu-Phe-Val Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@H](C(=O)N[C@@H](C(C)C)C(O)=O)CC1=CC=CC=C1 KXTAGESXNQEZKB-DZKIICNBSA-N 0.000 description 1
- AAJHGGDRKHYSDH-GUBZILKMSA-N Glu-Pro-Gln Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CCC(=O)O)N)C(=O)N[C@@H](CCC(=O)N)C(=O)O AAJHGGDRKHYSDH-GUBZILKMSA-N 0.000 description 1
- BPLNJYHNAJVLRT-ACZMJKKPSA-N Glu-Ser-Ala Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(O)=O BPLNJYHNAJVLRT-ACZMJKKPSA-N 0.000 description 1
- JWNZHMSRZXXGTM-XKBZYTNZSA-N Glu-Ser-Thr Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(O)=O JWNZHMSRZXXGTM-XKBZYTNZSA-N 0.000 description 1
- DMYACXMQUABZIQ-NRPADANISA-N Glu-Ser-Val Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(=O)N[C@@H](C(C)C)C(O)=O DMYACXMQUABZIQ-NRPADANISA-N 0.000 description 1
- FGGKGJHCVMYGCD-UKJIMTQDSA-N Glu-Val-Ile Chemical compound [H]N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O FGGKGJHCVMYGCD-UKJIMTQDSA-N 0.000 description 1
- 102000030595 Glucokinase Human genes 0.000 description 1
- 108010021582 Glucokinase Proteins 0.000 description 1
- 101710122170 Glutamate dehydrogenase 1 Proteins 0.000 description 1
- 102100034009 Glutamate dehydrogenase 1, mitochondrial Human genes 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- MXXXVOYFNVJHMA-IUCAKERBSA-N Gly-Arg-Met Chemical compound CSCC[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)CN MXXXVOYFNVJHMA-IUCAKERBSA-N 0.000 description 1
- GGEJHJIXRBTJPD-BYPYZUCNSA-N Gly-Asn-Gly Chemical compound NCC(=O)N[C@@H](CC(N)=O)C(=O)NCC(O)=O GGEJHJIXRBTJPD-BYPYZUCNSA-N 0.000 description 1
- IXKRSKPKSLXIHN-YUMQZZPRSA-N Gly-Cys-Leu Chemical compound [H]NCC(=O)N[C@@H](CS)C(=O)N[C@@H](CC(C)C)C(O)=O IXKRSKPKSLXIHN-YUMQZZPRSA-N 0.000 description 1
- SOEATRRYCIPEHA-BQBZGAKWSA-N Gly-Glu-Glu Chemical compound [H]NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(O)=O SOEATRRYCIPEHA-BQBZGAKWSA-N 0.000 description 1
- HQRHFUYMGCHHJS-LURJTMIESA-N Gly-Gly-Arg Chemical compound NCC(=O)NCC(=O)N[C@H](C(O)=O)CCCN=C(N)N HQRHFUYMGCHHJS-LURJTMIESA-N 0.000 description 1
- YNIMVVJTPWCUJH-KBPBESRZSA-N Gly-His-Tyr Chemical compound [H]NCC(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(O)=O YNIMVVJTPWCUJH-KBPBESRZSA-N 0.000 description 1
- BHPQOIPBLYJNAW-NGZCFLSTSA-N Gly-Ile-Pro Chemical compound CC[C@H](C)[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)CN BHPQOIPBLYJNAW-NGZCFLSTSA-N 0.000 description 1
- HAXARWKYFIIHKD-ZKWXMUAHSA-N Gly-Ile-Ser Chemical compound NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O HAXARWKYFIIHKD-ZKWXMUAHSA-N 0.000 description 1
- UUYBFNKHOCJCHT-VHSXEESVSA-N Gly-Leu-Pro Chemical compound CC(C)C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)CN UUYBFNKHOCJCHT-VHSXEESVSA-N 0.000 description 1
- LOEANKRDMMVOGZ-YUMQZZPRSA-N Gly-Lys-Asp Chemical compound NCCCC[C@H](NC(=O)CN)C(=O)N[C@@H](CC(O)=O)C(O)=O LOEANKRDMMVOGZ-YUMQZZPRSA-N 0.000 description 1
- OOCFXNOVSLSHAB-IUCAKERBSA-N Gly-Pro-Pro Chemical compound NCC(=O)N1CCC[C@H]1C(=O)N1[C@H](C(O)=O)CCC1 OOCFXNOVSLSHAB-IUCAKERBSA-N 0.000 description 1
- YOBGUCWZPXJHTN-BQBZGAKWSA-N Gly-Ser-Arg Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCCN=C(N)N YOBGUCWZPXJHTN-BQBZGAKWSA-N 0.000 description 1
- WCORRBXVISTKQL-WHFBIAKZSA-N Gly-Ser-Ser Chemical compound NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(O)=O WCORRBXVISTKQL-WHFBIAKZSA-N 0.000 description 1
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical group NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 1
- 239000004471 Glycine Chemical group 0.000 description 1
- 102100039264 Glycogen [starch] synthase, liver Human genes 0.000 description 1
- 102100034125 Golgin subfamily A member 8A Human genes 0.000 description 1
- 102000008653 Growth factor receptor-bound protein 10 Human genes 0.000 description 1
- 108050000446 Growth factor receptor-bound protein 10 Proteins 0.000 description 1
- 108010078321 Guanylate Cyclase Proteins 0.000 description 1
- 102000014469 Guanylate cyclase Human genes 0.000 description 1
- 101150053933 HAT2 gene Proteins 0.000 description 1
- 101150031823 HSP70 gene Proteins 0.000 description 1
- 102100027529 Heat shock factor-binding protein 1 Human genes 0.000 description 1
- 108010020382 Hepatocyte Nuclear Factor 1-alpha Proteins 0.000 description 1
- 102100022057 Hepatocyte nuclear factor 1-alpha Human genes 0.000 description 1
- 102000005548 Hexokinase Human genes 0.000 description 1
- 108700040460 Hexokinases Proteins 0.000 description 1
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 description 1
- HQKADFMLECZIQJ-HVTMNAMFSA-N His-Glu-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)O)NC(=O)[C@H](CC1=CN=CN1)N HQKADFMLECZIQJ-HVTMNAMFSA-N 0.000 description 1
- IDQNVIWPPWAFSY-AVGNSLFASA-N His-His-Gln Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCC(N)=O)C(O)=O IDQNVIWPPWAFSY-AVGNSLFASA-N 0.000 description 1
- QCBYAHHNOHBXIH-UWVGGRQHSA-N His-Pro-Gly Chemical compound C([C@H](N)C(=O)N1[C@@H](CCC1)C(=O)NCC(O)=O)C1=CN=CN1 QCBYAHHNOHBXIH-UWVGGRQHSA-N 0.000 description 1
- VCBWXASUBZIFLQ-IHRRRGAJSA-N His-Pro-Leu Chemical compound [H]N[C@@H](CC1=CNC=N1)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CC(C)C)C(O)=O VCBWXASUBZIFLQ-IHRRRGAJSA-N 0.000 description 1
- IXQGOKWTQPCIQM-YJRXYDGGSA-N His-Thr-His Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CN=CN1)C(=O)O)NC(=O)[C@H](CC2=CN=CN2)N)O IXQGOKWTQPCIQM-YJRXYDGGSA-N 0.000 description 1
- ISQOVWDWRUONJH-YESZJQIVSA-N His-Tyr-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CC2=CC=C(C=C2)O)NC(=O)[C@H](CC3=CN=CN3)N)C(=O)O ISQOVWDWRUONJH-YESZJQIVSA-N 0.000 description 1
- 101710195459 Histidine triad nucleotide-binding protein Proteins 0.000 description 1
- 102100022893 Histone acetyltransferase KAT5 Human genes 0.000 description 1
- 101710116149 Histone acetyltransferase KAT5 Proteins 0.000 description 1
- 102000003893 Histone acetyltransferases Human genes 0.000 description 1
- 108090000246 Histone acetyltransferases Proteins 0.000 description 1
- 108090000353 Histone deacetylase Proteins 0.000 description 1
- 102000003964 Histone deacetylase Human genes 0.000 description 1
- 102100039121 Histone-lysine N-methyltransferase MECOM Human genes 0.000 description 1
- 108010033040 Histones Proteins 0.000 description 1
- 102000006947 Histones Human genes 0.000 description 1
- 102100027849 Homeobox protein GBX-2 Human genes 0.000 description 1
- 102100028411 Homeobox protein Hox-B3 Human genes 0.000 description 1
- 102100028404 Homeobox protein Hox-B4 Human genes 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101001136753 Homo sapiens 26S proteasome regulatory subunit 8 Proteins 0.000 description 1
- 101000640855 Homo sapiens 3-oxo-5-alpha-steroid 4-dehydrogenase 1 Proteins 0.000 description 1
- 101001118201 Homo sapiens 60S ribosomal protein L13 Proteins 0.000 description 1
- 101000853243 Homo sapiens 60S ribosomal protein L7a Proteins 0.000 description 1
- 101000684189 Homo sapiens ADP-ribosylation factor 4 Proteins 0.000 description 1
- 101000830424 Homo sapiens ATP-dependent RNA helicase DDX50 Proteins 0.000 description 1
- 101000963424 Homo sapiens Acetyl-CoA carboxylase 1 Proteins 0.000 description 1
- 101000929799 Homo sapiens Acyl-CoA-binding protein Proteins 0.000 description 1
- 101000819490 Homo sapiens Alpha-(1,6)-fucosyltransferase Proteins 0.000 description 1
- 101000694718 Homo sapiens Amine oxidase [flavin-containing] A Proteins 0.000 description 1
- 101000884046 Homo sapiens Aromatic-L-amino-acid decarboxylase Proteins 0.000 description 1
- 101100111180 Homo sapiens BANF1 gene Proteins 0.000 description 1
- 101000903937 Homo sapiens Bax inhibitor 1 Proteins 0.000 description 1
- 101001016707 Homo sapiens Beta-mannosidase Proteins 0.000 description 1
- 101000984926 Homo sapiens Butyrophilin subfamily 2 member A1 Proteins 0.000 description 1
- 101001076862 Homo sapiens C-Jun-amino-terminal kinase-interacting protein 4 Proteins 0.000 description 1
- 101000894379 Homo sapiens C-terminal-binding protein 1 Proteins 0.000 description 1
- 101000836774 Homo sapiens CMP-N-acetylneuraminate-beta-galactosamide-alpha-2,3-sialyltransferase 1 Proteins 0.000 description 1
- 101000912652 Homo sapiens Claudin-7 Proteins 0.000 description 1
- 101000945060 Homo sapiens Clusterin-associated protein 1 Proteins 0.000 description 1
- 101000944341 Homo sapiens Cyclin-dependent kinase 18 Proteins 0.000 description 1
- 101000944345 Homo sapiens Cyclin-dependent kinase 19 Proteins 0.000 description 1
- 101000980930 Homo sapiens Cyclin-dependent kinase 9 Proteins 0.000 description 1
- 101000726258 Homo sapiens Cysteine-rich secretory protein 3 Proteins 0.000 description 1
- 101000922386 Homo sapiens Cytochrome b5 Proteins 0.000 description 1
- 101001018431 Homo sapiens DNA replication licensing factor MCM7 Proteins 0.000 description 1
- 101000945982 Homo sapiens Delta(14)-sterol reductase LBR Proteins 0.000 description 1
- 101000837994 Homo sapiens Dynactin-associated protein Proteins 0.000 description 1
- 101000817607 Homo sapiens Dynamin-2 Proteins 0.000 description 1
- 101000583444 Homo sapiens E3 SUMO-protein ligase PIAS3 Proteins 0.000 description 1
- 101000680670 Homo sapiens E3 ubiquitin-protein ligase Midline-1 Proteins 0.000 description 1
- 101001023703 Homo sapiens E3 ubiquitin-protein ligase NEDD4-like Proteins 0.000 description 1
- 101000712013 Homo sapiens E3 ubiquitin-protein ligase RNF14 Proteins 0.000 description 1
- 101001107086 Homo sapiens E3 ubiquitin-protein ligase RNF4 Proteins 0.000 description 1
- 101000633723 Homo sapiens E3 ubiquitin-protein ligase TTC3 Proteins 0.000 description 1
- 101001012120 Homo sapiens EPM2A-interacting protein 1 Proteins 0.000 description 1
- 101000813745 Homo sapiens ETS translocation variant 5 Proteins 0.000 description 1
- 101001057141 Homo sapiens Ecotropic viral integration site 5 protein homolog Proteins 0.000 description 1
- 101000877456 Homo sapiens Ectoderm-neural cortex protein 1 Proteins 0.000 description 1
- 101001010541 Homo sapiens Electron transfer flavoprotein subunit alpha, mitochondrial Proteins 0.000 description 1
- 101001011859 Homo sapiens Elongin-A Proteins 0.000 description 1
- 101001011846 Homo sapiens Elongin-B Proteins 0.000 description 1
- 101000881731 Homo sapiens Elongin-C Proteins 0.000 description 1
- 101001010910 Homo sapiens Estrogen receptor beta Proteins 0.000 description 1
- 101001057564 Homo sapiens Etoposide-induced protein 2.4 homolog Proteins 0.000 description 1
- 101001054360 Homo sapiens Eukaryotic translation initiation factor 4H Proteins 0.000 description 1
- 101001002481 Homo sapiens Eukaryotic translation initiation factor 5 Proteins 0.000 description 1
- 101100066427 Homo sapiens FCGR1A gene Proteins 0.000 description 1
- 101000914701 Homo sapiens FERM, ARHGEF and pleckstrin domain-containing protein 1 Proteins 0.000 description 1
- 101001062855 Homo sapiens Fatty acid-binding protein 5 Proteins 0.000 description 1
- 101000843611 Homo sapiens Ferrochelatase, mitochondrial Proteins 0.000 description 1
- 101000917237 Homo sapiens Fibroblast growth factor 10 Proteins 0.000 description 1
- 101001060261 Homo sapiens Fibroblast growth factor 7 Proteins 0.000 description 1
- 101001052785 Homo sapiens Ficolin-1 Proteins 0.000 description 1
- 101000907578 Homo sapiens Forkhead box protein M1 Proteins 0.000 description 1
- 101000930963 Homo sapiens Forkhead box protein O3B Proteins 0.000 description 1
- 101000893968 Homo sapiens G antigen 7 Proteins 0.000 description 1
- 101000870806 Homo sapiens G-rich sequence factor 1 Proteins 0.000 description 1
- 101000980756 Homo sapiens G1/S-specific cyclin-D1 Proteins 0.000 description 1
- 101000738575 Homo sapiens G1/S-specific cyclin-E2 Proteins 0.000 description 1
- 101100449148 Homo sapiens GOLGA8A gene Proteins 0.000 description 1
- 101000744505 Homo sapiens GTPase NRas Proteins 0.000 description 1
- 101001051083 Homo sapiens Galectin-12 Proteins 0.000 description 1
- 101000608769 Homo sapiens Galectin-8 Proteins 0.000 description 1
- 101000822438 Homo sapiens Gamma-aminobutyric acid receptor-associated protein-like 2 Proteins 0.000 description 1
- 101001034009 Homo sapiens Glutamate receptor-interacting protein 1 Proteins 0.000 description 1
- 101001072655 Homo sapiens Glutamyl-tRNA(Gln) amidotransferase subunit A, mitochondrial Proteins 0.000 description 1
- 101001036117 Homo sapiens Glycogen [starch] synthase, liver Proteins 0.000 description 1
- 101001062353 Homo sapiens Hepatocyte nuclear factor 3-alpha Proteins 0.000 description 1
- 101001045740 Homo sapiens Hepatocyte nuclear factor 4-alpha Proteins 0.000 description 1
- 101001045749 Homo sapiens Hepatocyte nuclear factor 4-gamma Proteins 0.000 description 1
- 101001035375 Homo sapiens Histone H1.2 Proteins 0.000 description 1
- 101001033728 Homo sapiens Histone-lysine N-methyltransferase MECOM Proteins 0.000 description 1
- 101000859754 Homo sapiens Homeobox protein GBX-2 Proteins 0.000 description 1
- 101000839775 Homo sapiens Homeobox protein Hox-B3 Proteins 0.000 description 1
- 101000839788 Homo sapiens Homeobox protein Hox-B4 Proteins 0.000 description 1
- 101001056180 Homo sapiens Induced myeloid leukemia cell differentiation protein Mcl-1 Proteins 0.000 description 1
- 101000633984 Homo sapiens Influenza virus NS1A-binding protein Proteins 0.000 description 1
- 101001076642 Homo sapiens Inosine-5'-monophosphate dehydrogenase 2 Proteins 0.000 description 1
- 101001076292 Homo sapiens Insulin-like growth factor II Proteins 0.000 description 1
- 101001044927 Homo sapiens Insulin-like growth factor-binding protein 3 Proteins 0.000 description 1
- 101000840566 Homo sapiens Insulin-like growth factor-binding protein 5 Proteins 0.000 description 1
- 101000605522 Homo sapiens Kallikrein-1 Proteins 0.000 description 1
- 101000605528 Homo sapiens Kallikrein-2 Proteins 0.000 description 1
- 101001050559 Homo sapiens Kinesin-1 heavy chain Proteins 0.000 description 1
- 101001044093 Homo sapiens Lipopolysaccharide-induced tumor necrosis factor-alpha factor Proteins 0.000 description 1
- 101100456570 Homo sapiens MED12 gene Proteins 0.000 description 1
- 101001011886 Homo sapiens Matrix metalloproteinase-16 Proteins 0.000 description 1
- 101000955333 Homo sapiens Mediator of RNA polymerase II transcription subunit 10 Proteins 0.000 description 1
- 101001055444 Homo sapiens Mediator of RNA polymerase II transcription subunit 20 Proteins 0.000 description 1
- 101001019117 Homo sapiens Mediator of RNA polymerase II transcription subunit 23 Proteins 0.000 description 1
- 101001019109 Homo sapiens Mediator of RNA polymerase II transcription subunit 24 Proteins 0.000 description 1
- 101000574992 Homo sapiens Mediator of RNA polymerase II transcription subunit 26 Proteins 0.000 description 1
- 101000955282 Homo sapiens Mediator of RNA polymerase II transcription subunit 27 Proteins 0.000 description 1
- 101001033754 Homo sapiens Mediator of RNA polymerase II transcription subunit 31 Proteins 0.000 description 1
- 101000962119 Homo sapiens Mediator of RNA polymerase II transcription subunit 4 Proteins 0.000 description 1
- 101001055354 Homo sapiens Mediator of RNA polymerase II transcription subunit 6 Proteins 0.000 description 1
- 101000582864 Homo sapiens Mediator of RNA polymerase II transcription subunit 7 Proteins 0.000 description 1
- 101000822604 Homo sapiens Methanethiol oxidase Proteins 0.000 description 1
- 101000738911 Homo sapiens Mismatch repair endonuclease PMS2 Proteins 0.000 description 1
- 101000853064 Homo sapiens Mitochondrial import inner membrane translocase subunit Tim8 B Proteins 0.000 description 1
- 101001018153 Homo sapiens Mitogen-activated protein kinase kinase kinase 1 Proteins 0.000 description 1
- 101000577033 Homo sapiens Monocarboxylate transporter 7 Proteins 0.000 description 1
- 101000928259 Homo sapiens NADPH:adrenodoxin oxidoreductase, mitochondrial Proteins 0.000 description 1
- 101000581984 Homo sapiens Neural cell adhesion molecule 2 Proteins 0.000 description 1
- 101000974356 Homo sapiens Nuclear receptor coactivator 3 Proteins 0.000 description 1
- 101000603323 Homo sapiens Nuclear receptor subfamily 0 group B member 1 Proteins 0.000 description 1
- 101000633516 Homo sapiens Nuclear receptor subfamily 2 group F member 6 Proteins 0.000 description 1
- 101001109698 Homo sapiens Nuclear receptor subfamily 4 group A member 2 Proteins 0.000 description 1
- 101000912678 Homo sapiens Nucleolar RNA helicase 2 Proteins 0.000 description 1
- 101000721136 Homo sapiens Origin recognition complex subunit 5 Proteins 0.000 description 1
- 101001114057 Homo sapiens P antigen family member 1 Proteins 0.000 description 1
- 101001114052 Homo sapiens P antigen family member 4 Proteins 0.000 description 1
- 101100406818 Homo sapiens PAGE4 gene Proteins 0.000 description 1
- 101000871508 Homo sapiens PTB domain-containing engulfment adapter protein 1 Proteins 0.000 description 1
- 101001060744 Homo sapiens Peptidyl-prolyl cis-trans isomerase FKBP1A Proteins 0.000 description 1
- 101000878253 Homo sapiens Peptidyl-prolyl cis-trans isomerase FKBP5 Proteins 0.000 description 1
- 101000755630 Homo sapiens Peripheral-type benzodiazepine receptor-associated protein 1 Proteins 0.000 description 1
- 101001087045 Homo sapiens Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN Proteins 0.000 description 1
- 101001077441 Homo sapiens Potassium voltage-gated channel subfamily S member 3 Proteins 0.000 description 1
- 101000610107 Homo sapiens Pre-B-cell leukemia transcription factor 1 Proteins 0.000 description 1
- 101000914035 Homo sapiens Pre-mRNA-splicing regulator WTAP Proteins 0.000 description 1
- 101001035260 Homo sapiens Probable E3 ubiquitin-protein ligase HERC3 Proteins 0.000 description 1
- 101000702559 Homo sapiens Probable global transcription activator SNF2L2 Proteins 0.000 description 1
- 101000577585 Homo sapiens Proline dehydrogenase 1, mitochondrial Proteins 0.000 description 1
- 101001135391 Homo sapiens Prostaglandin E synthase Proteins 0.000 description 1
- 101000605534 Homo sapiens Prostate-specific antigen Proteins 0.000 description 1
- 101001001272 Homo sapiens Prostatic acid phosphatase Proteins 0.000 description 1
- 101000933601 Homo sapiens Protein BTG1 Proteins 0.000 description 1
- 101001062760 Homo sapiens Protein FAM13A Proteins 0.000 description 1
- 101001050612 Homo sapiens Protein KHNYN Proteins 0.000 description 1
- 101001046603 Homo sapiens Protein KIBRA Proteins 0.000 description 1
- 101000979748 Homo sapiens Protein NDRG1 Proteins 0.000 description 1
- 101000614095 Homo sapiens Proton-activated chloride channel Proteins 0.000 description 1
- 101001120726 Homo sapiens Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial Proteins 0.000 description 1
- 101001092166 Homo sapiens RPE-retinal G protein-coupled receptor Proteins 0.000 description 1
- 101001061915 Homo sapiens Rab3 GTPase-activating protein catalytic subunit Proteins 0.000 description 1
- 101001130509 Homo sapiens Ras GTPase-activating protein 1 Proteins 0.000 description 1
- 101000712725 Homo sapiens Ras-related protein Rab-7L1 Proteins 0.000 description 1
- 101001077369 Homo sapiens Receptor of activated protein C kinase 1 Proteins 0.000 description 1
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 1
- 101001096522 Homo sapiens Regulator of G-protein signaling 5 Proteins 0.000 description 1
- 101001092125 Homo sapiens Replication protein A 70 kDa DNA-binding subunit Proteins 0.000 description 1
- 101000742859 Homo sapiens Retinoblastoma-associated protein Proteins 0.000 description 1
- 101001093899 Homo sapiens Retinoic acid receptor RXR-alpha Proteins 0.000 description 1
- 101000640876 Homo sapiens Retinoic acid receptor RXR-beta Proteins 0.000 description 1
- 101000973629 Homo sapiens Ribosome quality control complex subunit NEMF Proteins 0.000 description 1
- 101000836005 Homo sapiens S-phase kinase-associated protein 1 Proteins 0.000 description 1
- 101000881168 Homo sapiens SPARC Proteins 0.000 description 1
- 101000652133 Homo sapiens STE20-like serine/threonine-protein kinase Proteins 0.000 description 1
- 101000836568 Homo sapiens Selenoprotein F Proteins 0.000 description 1
- 101000632056 Homo sapiens Septin-9 Proteins 0.000 description 1
- 101000700733 Homo sapiens Serine/arginine-rich splicing factor 8 Proteins 0.000 description 1
- 101000880439 Homo sapiens Serine/threonine-protein kinase 3 Proteins 0.000 description 1
- 101001059454 Homo sapiens Serine/threonine-protein kinase MARK2 Proteins 0.000 description 1
- 101000653812 Homo sapiens Small nuclear ribonucleoprotein E Proteins 0.000 description 1
- 101000665250 Homo sapiens Small nuclear ribonucleoprotein Sm D2 Proteins 0.000 description 1
- 101000789523 Homo sapiens Sodium/potassium-transporting ATPase subunit beta-1 Proteins 0.000 description 1
- 101000713275 Homo sapiens Solute carrier family 22 member 3 Proteins 0.000 description 1
- 101000629638 Homo sapiens Sorbin and SH3 domain-containing protein 2 Proteins 0.000 description 1
- 101000642262 Homo sapiens Spondin-1 Proteins 0.000 description 1
- 101000642258 Homo sapiens Spondin-2 Proteins 0.000 description 1
- 101000851696 Homo sapiens Steroid hormone receptor ERR2 Proteins 0.000 description 1
- 101000687808 Homo sapiens Suppressor of cytokine signaling 2 Proteins 0.000 description 1
- 101000687855 Homo sapiens Suppressor of cytokine signaling 3 Proteins 0.000 description 1
- 101000652226 Homo sapiens Suppressor of cytokine signaling 6 Proteins 0.000 description 1
- 101000652300 Homo sapiens Synaptosomal-associated protein 23 Proteins 0.000 description 1
- 101000648624 Homo sapiens TATA element modulatory factor Proteins 0.000 description 1
- 101000666340 Homo sapiens Tenascin Proteins 0.000 description 1
- 101000796121 Homo sapiens Thioredoxin-like protein 1 Proteins 0.000 description 1
- 101000891321 Homo sapiens Transcobalamin-2 Proteins 0.000 description 1
- 101000702545 Homo sapiens Transcription activator BRG1 Proteins 0.000 description 1
- 101000652684 Homo sapiens Transcriptional adapter 3 Proteins 0.000 description 1
- 101000635938 Homo sapiens Transforming growth factor beta-1 proprotein Proteins 0.000 description 1
- 101000712658 Homo sapiens Transforming growth factor beta-1-induced transcript 1 protein Proteins 0.000 description 1
- 101000755529 Homo sapiens Transforming protein RhoA Proteins 0.000 description 1
- 101000680271 Homo sapiens Transmembrane protein 59 Proteins 0.000 description 1
- 101000987017 Homo sapiens Tumor protein p53-inducible protein 11 Proteins 0.000 description 1
- 101100427169 Homo sapiens UBE2V1 gene Proteins 0.000 description 1
- 101000939452 Homo sapiens UDP-glucuronosyltransferase 2B7 Proteins 0.000 description 1
- 101000772888 Homo sapiens Ubiquitin-protein ligase E3A Proteins 0.000 description 1
- 101000964425 Homo sapiens Zinc finger and BTB domain-containing protein 16 Proteins 0.000 description 1
- 101000916537 Homo sapiens Zinc finger and BTB domain-containing protein 43 Proteins 0.000 description 1
- 101000772560 Homo sapiens Zinc finger transcription factor Trps1 Proteins 0.000 description 1
- 206010062904 Hormone-refractory prostate cancer Diseases 0.000 description 1
- 102000003839 Human Proteins Human genes 0.000 description 1
- 108090000144 Human Proteins Proteins 0.000 description 1
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 1
- GRRNUXAQVGOGFE-UHFFFAOYSA-N Hygromycin-B Natural products OC1C(NC)CC(N)C(O)C1OC1C2OC3(C(C(O)C(O)C(C(N)CO)O3)O)OC2C(O)C(CO)O1 GRRNUXAQVGOGFE-UHFFFAOYSA-N 0.000 description 1
- 101150088952 IGF1 gene Proteins 0.000 description 1
- WUEIUSDAECDLQO-NAKRPEOUSA-N Ile-Ala-Met Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)O)N WUEIUSDAECDLQO-NAKRPEOUSA-N 0.000 description 1
- BSWLQVGEVFYGIM-ZPFDUUQYSA-N Ile-Gln-Arg Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCC(=O)N)C(=O)N[C@@H](CCCN=C(N)N)C(=O)O)N BSWLQVGEVFYGIM-ZPFDUUQYSA-N 0.000 description 1
- BBQABUDWDUKJMB-LZXPERKUSA-N Ile-Ile-Ile Chemical compound CC[C@H](C)[C@H]([NH3+])C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C([O-])=O BBQABUDWDUKJMB-LZXPERKUSA-N 0.000 description 1
- NNVXABCGXOLIEB-PYJNHQTQSA-N Ile-Met-His Chemical compound CC[C@H](C)[C@H](N)C(=O)N[C@@H](CCSC)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 NNVXABCGXOLIEB-PYJNHQTQSA-N 0.000 description 1
- YKZAMJXNJUWFIK-JBDRJPRFSA-N Ile-Ser-Ala Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H](C)C(=O)O)N YKZAMJXNJUWFIK-JBDRJPRFSA-N 0.000 description 1
- 102100026539 Induced myeloid leukemia cell differentiation protein Mcl-1 Human genes 0.000 description 1
- 102100029241 Influenza virus NS1A-binding protein Human genes 0.000 description 1
- 101710172331 Inosine-5'-monophosphate dehydrogenase 2 Proteins 0.000 description 1
- 102000016600 Inosine-5'-monophosphate dehydrogenases Human genes 0.000 description 1
- 108050006182 Inosine-5'-monophosphate dehydrogenases Proteins 0.000 description 1
- 108010032354 Inositol 1,4,5-Trisphosphate Receptors Proteins 0.000 description 1
- 102000007640 Inositol 1,4,5-Trisphosphate Receptors Human genes 0.000 description 1
- 108700001097 Insect Genes Proteins 0.000 description 1
- 102000004877 Insulin Human genes 0.000 description 1
- 108090001061 Insulin Proteins 0.000 description 1
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 1
- 102100025947 Insulin-like growth factor II Human genes 0.000 description 1
- 102100022708 Insulin-like growth factor-binding protein 3 Human genes 0.000 description 1
- 102100029225 Insulin-like growth factor-binding protein 5 Human genes 0.000 description 1
- 102100036706 Interleukin-1 receptor-like 1 Human genes 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- PWWVAXIEGOYWEE-UHFFFAOYSA-N Isophenergan Chemical compound C1=CC=C2N(CC(C)N(C)C)C3=CC=CC=C3SC2=C1 PWWVAXIEGOYWEE-UHFFFAOYSA-N 0.000 description 1
- 102100038297 Kallikrein-1 Human genes 0.000 description 1
- 102100038356 Kallikrein-2 Human genes 0.000 description 1
- 102100034872 Kallikrein-4 Human genes 0.000 description 1
- 108010062228 Karyopherins Proteins 0.000 description 1
- 102000011781 Karyopherins Human genes 0.000 description 1
- 102100023422 Kinesin-1 heavy chain Human genes 0.000 description 1
- 241000235649 Kluyveromyces Species 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical group OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 102000007330 LDL Lipoproteins Human genes 0.000 description 1
- 108010001831 LDL receptors Proteins 0.000 description 1
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 1
- 101710137448 Lathosterol oxidase Proteins 0.000 description 1
- 102100037199 Lathosterol oxidase Human genes 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 241000880493 Leptailurus serval Species 0.000 description 1
- VIWUBXKCYJGNCL-SRVKXCTJSA-N Leu-Asn-His Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(O)=O)CC1=CN=CN1 VIWUBXKCYJGNCL-SRVKXCTJSA-N 0.000 description 1
- GLBNEGIOFRVRHO-JYJNAYRXSA-N Leu-Gln-Phe Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O GLBNEGIOFRVRHO-JYJNAYRXSA-N 0.000 description 1
- NEEOBPIXKWSBRF-IUCAKERBSA-N Leu-Glu-Gly Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O NEEOBPIXKWSBRF-IUCAKERBSA-N 0.000 description 1
- QVFGXCVIXXBFHO-AVGNSLFASA-N Leu-Glu-Leu Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O QVFGXCVIXXBFHO-AVGNSLFASA-N 0.000 description 1
- LAGPXKYZCCTSGQ-JYJNAYRXSA-N Leu-Glu-Phe Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O LAGPXKYZCCTSGQ-JYJNAYRXSA-N 0.000 description 1
- WQWSMEOYXJTFRU-GUBZILKMSA-N Leu-Glu-Ser Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CO)C(O)=O WQWSMEOYXJTFRU-GUBZILKMSA-N 0.000 description 1
- VWHGTYCRDRBSFI-ZETCQYMHSA-N Leu-Gly-Gly Chemical compound CC(C)C[C@H](N)C(=O)NCC(=O)NCC(O)=O VWHGTYCRDRBSFI-ZETCQYMHSA-N 0.000 description 1
- AOFYPTOHESIBFZ-KKUMJFAQSA-N Leu-His-His Chemical compound CC(C)C[C@H](N)C(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@@H](Cc1cnc[nH]1)C(O)=O AOFYPTOHESIBFZ-KKUMJFAQSA-N 0.000 description 1
- KOSWSHVQIVTVQF-ZPFDUUQYSA-N Leu-Ile-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(O)=O)C(O)=O KOSWSHVQIVTVQF-ZPFDUUQYSA-N 0.000 description 1
- WXZOHBVPVKABQN-DCAQKATOSA-N Leu-Met-Asp Chemical compound CC(C)C[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(=O)O)C(=O)O)N WXZOHBVPVKABQN-DCAQKATOSA-N 0.000 description 1
- IZPVWNSAVUQBGP-CIUDSAMLSA-N Leu-Ser-Asp Chemical compound [H]N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O IZPVWNSAVUQBGP-CIUDSAMLSA-N 0.000 description 1
- 102100021747 Leukemia inhibitory factor receptor Human genes 0.000 description 1
- 102100021607 Lipopolysaccharide-induced tumor necrosis factor-alpha factor Human genes 0.000 description 1
- 102100024640 Low-density lipoprotein receptor Human genes 0.000 description 1
- 102100027105 Lymphocyte-specific protein 1 Human genes 0.000 description 1
- LMVOVCYVZBBWQB-SRVKXCTJSA-N Lys-Asp-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN LMVOVCYVZBBWQB-SRVKXCTJSA-N 0.000 description 1
- IMAKMJCBYCSMHM-AVGNSLFASA-N Lys-Glu-Lys Chemical compound NCCCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@H](C(O)=O)CCCCN IMAKMJCBYCSMHM-AVGNSLFASA-N 0.000 description 1
- WRODMZBHNNPRLN-SRVKXCTJSA-N Lys-Leu-Ser Chemical compound [H]N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CO)C(O)=O WRODMZBHNNPRLN-SRVKXCTJSA-N 0.000 description 1
- PDIDTSZKKFEDMB-UWVGGRQHSA-N Lys-Pro-Gly Chemical compound [H]N[C@@H](CCCCN)C(=O)N1CCC[C@H]1C(=O)NCC(O)=O PDIDTSZKKFEDMB-UWVGGRQHSA-N 0.000 description 1
- 102100033247 Lysine-specific demethylase 5B Human genes 0.000 description 1
- 101710105712 Lysine-specific demethylase 5B Proteins 0.000 description 1
- 108010068997 Mannose-Binding Lectins Proteins 0.000 description 1
- 102000001698 Mannose-Binding Lectins Human genes 0.000 description 1
- 108010054377 Mannosidases Proteins 0.000 description 1
- 102000001696 Mannosidases Human genes 0.000 description 1
- 102100030200 Matrix metalloproteinase-16 Human genes 0.000 description 1
- 102100038976 Mediator of RNA polymerase II transcription subunit 10 Human genes 0.000 description 1
- 102100021070 Mediator of RNA polymerase II transcription subunit 12 Human genes 0.000 description 1
- 102100026161 Mediator of RNA polymerase II transcription subunit 13 Human genes 0.000 description 1
- 101710179289 Mediator of RNA polymerase II transcription subunit 17 Proteins 0.000 description 1
- 102100026165 Mediator of RNA polymerase II transcription subunit 20 Human genes 0.000 description 1
- 102100034771 Mediator of RNA polymerase II transcription subunit 23 Human genes 0.000 description 1
- 102100025546 Mediator of RNA polymerase II transcription subunit 26 Human genes 0.000 description 1
- 102100039001 Mediator of RNA polymerase II transcription subunit 27 Human genes 0.000 description 1
- 102100039122 Mediator of RNA polymerase II transcription subunit 31 Human genes 0.000 description 1
- 102100039206 Mediator of RNA polymerase II transcription subunit 4 Human genes 0.000 description 1
- 102100026174 Mediator of RNA polymerase II transcription subunit 6 Human genes 0.000 description 1
- 102100030235 Mediator of RNA polymerase II transcription subunit 7 Human genes 0.000 description 1
- 102100025075 Melanoma-associated antigen 6 Human genes 0.000 description 1
- 108700031312 Membrane Cofactor Proteins 0.000 description 1
- 102000050019 Membrane Cofactor Human genes 0.000 description 1
- 101710146216 Membrane cofactor protein Proteins 0.000 description 1
- ONGCSGVHCSAATF-CIUDSAMLSA-N Met-Ala-Glu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](C)C(=O)N[C@H](C(O)=O)CCC(O)=O ONGCSGVHCSAATF-CIUDSAMLSA-N 0.000 description 1
- TZLYIHDABYBOCJ-FXQIFTODSA-N Met-Asp-Ser Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C(O)=O TZLYIHDABYBOCJ-FXQIFTODSA-N 0.000 description 1
- YORIKIDJCPKBON-YUMQZZPRSA-N Met-Glu-Gly Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O YORIKIDJCPKBON-YUMQZZPRSA-N 0.000 description 1
- SJDQOYTYNGZZJX-SRVKXCTJSA-N Met-Glu-Leu Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(O)=O SJDQOYTYNGZZJX-SRVKXCTJSA-N 0.000 description 1
- XKJUFUPCHARJKX-UWVGGRQHSA-N Met-Gly-His Chemical compound CSCC[C@H](N)C(=O)NCC(=O)N[C@H](C(O)=O)CC1=CNC=N1 XKJUFUPCHARJKX-UWVGGRQHSA-N 0.000 description 1
- CKAVKDJBSNTJDB-SRVKXCTJSA-N Met-Val-Met Chemical compound CSCC[C@H](N)C(=O)N[C@@H](C(C)C)C(=O)N[C@H](C(O)=O)CCSC CKAVKDJBSNTJDB-SRVKXCTJSA-N 0.000 description 1
- 102000003792 Metallothionein Human genes 0.000 description 1
- 108090000157 Metallothionein Proteins 0.000 description 1
- 102100022465 Methanethiol oxidase Human genes 0.000 description 1
- 102000016397 Methyltransferase Human genes 0.000 description 1
- 108700005443 Microbial Genes Proteins 0.000 description 1
- 108091022875 Microtubule Proteins 0.000 description 1
- 102000029749 Microtubule Human genes 0.000 description 1
- 102000003979 Mineralocorticoid Receptors Human genes 0.000 description 1
- 108090000375 Mineralocorticoid Receptors Proteins 0.000 description 1
- 102100037480 Mismatch repair endonuclease PMS2 Human genes 0.000 description 1
- 108010058682 Mitochondrial Proteins Proteins 0.000 description 1
- 102000006404 Mitochondrial Proteins Human genes 0.000 description 1
- 102100033115 Mitogen-activated protein kinase kinase kinase 1 Human genes 0.000 description 1
- 108010006519 Molecular Chaperones Proteins 0.000 description 1
- 102000005431 Molecular Chaperones Human genes 0.000 description 1
- 102100025311 Monocarboxylate transporter 7 Human genes 0.000 description 1
- 206010048723 Multiple-drug resistance Diseases 0.000 description 1
- 101100005550 Mus musculus Ccl1 gene Proteins 0.000 description 1
- 101000942699 Mus musculus Clusterin Proteins 0.000 description 1
- 101100061197 Mus musculus Cyp27b1 gene Proteins 0.000 description 1
- 101000967257 Mus musculus Homeobox protein MSX-1 Proteins 0.000 description 1
- 101000578250 Mus musculus Homeobox protein Nkx-3.1 Proteins 0.000 description 1
- 101001033610 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Inosine-5'-monophosphate dehydrogenase Proteins 0.000 description 1
- 102100035044 Myosin light chain kinase, smooth muscle Human genes 0.000 description 1
- 101710198035 Myosin light chain kinase, smooth muscle Proteins 0.000 description 1
- YBAFDPFAUTYYRW-UHFFFAOYSA-N N-L-alpha-glutamyl-L-leucine Natural products CC(C)CC(C(O)=O)NC(=O)C(N)CCC(O)=O YBAFDPFAUTYYRW-UHFFFAOYSA-N 0.000 description 1
- SITLTJHOQZFJGG-UHFFFAOYSA-N N-L-alpha-glutamyl-L-valine Natural products CC(C)C(C(O)=O)NC(=O)C(N)CCC(O)=O SITLTJHOQZFJGG-UHFFFAOYSA-N 0.000 description 1
- PESQCPHRXOFIPX-UHFFFAOYSA-N N-L-methionyl-L-tyrosine Natural products CSCCC(N)C(=O)NC(C(O)=O)CC1=CC=C(O)C=C1 PESQCPHRXOFIPX-UHFFFAOYSA-N 0.000 description 1
- BKAYIFDRRZZKNF-VIFPVBQESA-N N-acetylcarnosine Chemical compound CC(=O)NCCC(=O)N[C@H](C(O)=O)CC1=CN=CN1 BKAYIFDRRZZKNF-VIFPVBQESA-N 0.000 description 1
- PCNLLVFKBKMRDB-UHFFFAOYSA-N N-ethyl-N-[[2-(1-pentylindol-3-yl)-1,3-thiazol-4-yl]methyl]ethanamine Chemical compound C(C)N(CC=1N=C(SC=1)C1=CN(C2=CC=CC=C12)CCCCC)CC PCNLLVFKBKMRDB-UHFFFAOYSA-N 0.000 description 1
- 102100034449 N-myc-interactor Human genes 0.000 description 1
- 102000002023 NADH:ubiquinone oxidoreductases Human genes 0.000 description 1
- 108050009313 NADH:ubiquinone oxidoreductases Proteins 0.000 description 1
- 108010047562 NGR peptide Proteins 0.000 description 1
- 108091008640 NR2F Proteins 0.000 description 1
- BQVUABVGYYSDCJ-UHFFFAOYSA-N Nalpha-L-Leucyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)C(N)CC(C)C)C(O)=O)=CNC2=C1 BQVUABVGYYSDCJ-UHFFFAOYSA-N 0.000 description 1
- 206010061309 Neoplasm progression Diseases 0.000 description 1
- 102100030467 Neural cell adhesion molecule 2 Human genes 0.000 description 1
- 101710116808 Neural cell adhesion molecule 2 Proteins 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 101150095442 Nr1h2 gene Proteins 0.000 description 1
- 108010051791 Nuclear Antigens Proteins 0.000 description 1
- 102000019040 Nuclear Antigens Human genes 0.000 description 1
- 108090001146 Nuclear Receptor Coactivator 1 Proteins 0.000 description 1
- 108090001145 Nuclear Receptor Coactivator 3 Proteins 0.000 description 1
- 108010062309 Nuclear Receptor Interacting Protein 1 Proteins 0.000 description 1
- 102100037223 Nuclear receptor coactivator 1 Human genes 0.000 description 1
- 102100023170 Nuclear receptor subfamily 1 group D member 1 Human genes 0.000 description 1
- 102100022676 Nuclear receptor subfamily 4 group A member 2 Human genes 0.000 description 1
- 102100029558 Nuclear receptor-interacting protein 1 Human genes 0.000 description 1
- 102100027441 Nucleobindin-2 Human genes 0.000 description 1
- 102100026100 Nucleolar RNA helicase 2 Human genes 0.000 description 1
- 108010064527 OSM-LIF Receptors Proteins 0.000 description 1
- 108010026867 Oligo-1,6-Glucosidase Proteins 0.000 description 1
- 102100025200 Origin recognition complex subunit 5 Human genes 0.000 description 1
- 102100020727 PAT complex subunit Asterix Human genes 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 102000017946 PGC-1 Human genes 0.000 description 1
- 108700038399 PGC-1 Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 108010087702 Penicillinase Proteins 0.000 description 1
- 102100037827 Peptidyl-prolyl cis-trans isomerase D Human genes 0.000 description 1
- 102100027913 Peptidyl-prolyl cis-trans isomerase FKBP1A Human genes 0.000 description 1
- 239000001888 Peptone Substances 0.000 description 1
- 108010080698 Peptones Proteins 0.000 description 1
- 102100022369 Peripheral-type benzodiazepine receptor-associated protein 1 Human genes 0.000 description 1
- 101710170024 Peroxisomal membrane protein PEX16 Proteins 0.000 description 1
- CTNODEMQIKCZGQ-JYJNAYRXSA-N Phe-Gln-His Chemical compound C([C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1NC=NC=1)C(O)=O)C1=CC=CC=C1 CTNODEMQIKCZGQ-JYJNAYRXSA-N 0.000 description 1
- IDUCUXTUHHIQIP-SOUVJXGZSA-N Phe-Gln-Pro Chemical compound C1C[C@@H](N(C1)C(=O)[C@H](CCC(=O)N)NC(=O)[C@H](CC2=CC=CC=C2)N)C(=O)O IDUCUXTUHHIQIP-SOUVJXGZSA-N 0.000 description 1
- SWCOXQLDICUYOL-ULQDDVLXSA-N Phe-His-Arg Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H](CC1=CNC=N1)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O SWCOXQLDICUYOL-ULQDDVLXSA-N 0.000 description 1
- WKTSCAXSYITIJJ-PCBIJLKTSA-N Phe-Ile-Asn Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC(N)=O)C(O)=O WKTSCAXSYITIJJ-PCBIJLKTSA-N 0.000 description 1
- CWFGECHCRMGPPT-MXAVVETBSA-N Phe-Ile-Ser Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O CWFGECHCRMGPPT-MXAVVETBSA-N 0.000 description 1
- GMWNQSGWWGKTSF-LFSVMHDDSA-N Phe-Thr-Ala Chemical compound [H]N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C)C(O)=O GMWNQSGWWGKTSF-LFSVMHDDSA-N 0.000 description 1
- 102000001107 Phosphatidate Phosphatase Human genes 0.000 description 1
- 108010069394 Phosphatidate Phosphatase Proteins 0.000 description 1
- 108010069341 Phosphofructokinases Proteins 0.000 description 1
- 102000001105 Phosphofructokinases Human genes 0.000 description 1
- 102000045595 Phosphoprotein Phosphatases Human genes 0.000 description 1
- 108700019535 Phosphoprotein Phosphatases Proteins 0.000 description 1
- 102000007982 Phosphoproteins Human genes 0.000 description 1
- 108010089430 Phosphoproteins Proteins 0.000 description 1
- 241000235648 Pichia Species 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 102100024078 Plasma serine protease inhibitor Human genes 0.000 description 1
- 102100034055 Plasminogen activator inhibitor 1 RNA-binding protein Human genes 0.000 description 1
- 102100035182 Plastin-2 Human genes 0.000 description 1
- 102100034961 Poly(rC)-binding protein 2 Human genes 0.000 description 1
- 101710089647 Poly(rC)-binding protein 2 Proteins 0.000 description 1
- 101710101680 Polyadenylate-binding protein-interacting protein 1 Proteins 0.000 description 1
- 241001505332 Polyomavirus sp. Species 0.000 description 1
- 102100025068 Potassium voltage-gated channel subfamily S member 3 Human genes 0.000 description 1
- 101000621511 Potato virus M (strain German) RNA silencing suppressor Proteins 0.000 description 1
- 102100040171 Pre-B-cell leukemia transcription factor 1 Human genes 0.000 description 1
- ICTZKEXYDDZZFP-SRVKXCTJSA-N Pro-Arg-Pro Chemical compound N([C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(O)=O)C(=O)[C@@H]1CCCN1 ICTZKEXYDDZZFP-SRVKXCTJSA-N 0.000 description 1
- TUYWCHPXKQTISF-LPEHRKFASA-N Pro-Cys-Pro Chemical compound C1C[C@H](NC1)C(=O)N[C@@H](CS)C(=O)N2CCC[C@@H]2C(=O)O TUYWCHPXKQTISF-LPEHRKFASA-N 0.000 description 1
- XJROSHJRQTXWAE-XGEHTFHBSA-N Pro-Cys-Thr Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CS)C(=O)N[C@@H]([C@@H](C)O)C(O)=O XJROSHJRQTXWAE-XGEHTFHBSA-N 0.000 description 1
- UAYHMOIGIQZLFR-NHCYSSNCSA-N Pro-Gln-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C(C)C)C(O)=O UAYHMOIGIQZLFR-NHCYSSNCSA-N 0.000 description 1
- DXTOOBDIIAJZBJ-BQBZGAKWSA-N Pro-Gly-Ser Chemical compound [H]N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CO)C(O)=O DXTOOBDIIAJZBJ-BQBZGAKWSA-N 0.000 description 1
- LXLFEIHKWGHJJB-XUXIUFHCSA-N Pro-Ile-Lys Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](CCCCN)C(=O)O)NC(=O)[C@@H]1CCCN1 LXLFEIHKWGHJJB-XUXIUFHCSA-N 0.000 description 1
- JLMZKEQFMVORMA-SRVKXCTJSA-N Pro-Pro-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@@H]1CCCN1C(=O)[C@H]1NCCC1 JLMZKEQFMVORMA-SRVKXCTJSA-N 0.000 description 1
- GMJDSFYVTAMIBF-FXQIFTODSA-N Pro-Ser-Asp Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(O)=O)C(O)=O GMJDSFYVTAMIBF-FXQIFTODSA-N 0.000 description 1
- FNGOXVQBBCMFKV-CIUDSAMLSA-N Pro-Ser-Glu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O FNGOXVQBBCMFKV-CIUDSAMLSA-N 0.000 description 1
- LNICFEXCAHIJOR-DCAQKATOSA-N Pro-Ser-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(C)C)C(O)=O LNICFEXCAHIJOR-DCAQKATOSA-N 0.000 description 1
- QKDIHFHGHBYTKB-IHRRRGAJSA-N Pro-Ser-Phe Chemical compound N([C@@H](CO)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C(=O)[C@@H]1CCCN1 QKDIHFHGHBYTKB-IHRRRGAJSA-N 0.000 description 1
- MKGIILKDUGDRRO-FXQIFTODSA-N Pro-Ser-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H]1CCCN1 MKGIILKDUGDRRO-FXQIFTODSA-N 0.000 description 1
- CHYAYDLYYIJCKY-OSUNSFLBSA-N Pro-Thr-Ile Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O CHYAYDLYYIJCKY-OSUNSFLBSA-N 0.000 description 1
- YHUBAXGAAYULJY-ULQDDVLXSA-N Pro-Tyr-Leu Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(C)C)C(O)=O YHUBAXGAAYULJY-ULQDDVLXSA-N 0.000 description 1
- FIDNSJUXESUDOV-JYJNAYRXSA-N Pro-Tyr-Val Chemical compound [H]N1CCC[C@H]1C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](C(C)C)C(O)=O FIDNSJUXESUDOV-JYJNAYRXSA-N 0.000 description 1
- 102100031021 Probable global transcription activator SNF2L2 Human genes 0.000 description 1
- 101710113723 Probable small nuclear ribonucleoprotein E Proteins 0.000 description 1
- 102000003946 Prolactin Human genes 0.000 description 1
- 108010057464 Prolactin Proteins 0.000 description 1
- 102100030350 Prolactin-inducible protein Human genes 0.000 description 1
- 101710187242 Prolactin-inducible protein homolog Proteins 0.000 description 1
- 102100036691 Proliferating cell nuclear antigen Human genes 0.000 description 1
- 102100028772 Proline dehydrogenase 1, mitochondrial Human genes 0.000 description 1
- 102100036365 Proprotein convertase subtilisin/kexin type 5 Human genes 0.000 description 1
- 101710180648 Proprotein convertase subtilisin/kexin type 5 Proteins 0.000 description 1
- 102100029500 Prostasin Human genes 0.000 description 1
- 108010018777 Prostatein Proteins 0.000 description 1
- 102100035703 Prostatic acid phosphatase Human genes 0.000 description 1
- 102100026036 Protein BTG1 Human genes 0.000 description 1
- 108010001953 Protein C Inhibitor Proteins 0.000 description 1
- 229940122929 Protein C inhibitor Drugs 0.000 description 1
- 102000006010 Protein Disulfide-Isomerase Human genes 0.000 description 1
- 102100022309 Protein KIBRA Human genes 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 102100024980 Protein NDRG1 Human genes 0.000 description 1
- 102000002727 Protein Tyrosine Phosphatase Human genes 0.000 description 1
- 108010018070 Proto-Oncogene Proteins c-ets Proteins 0.000 description 1
- 102000004053 Proto-Oncogene Proteins c-ets Human genes 0.000 description 1
- 102000007568 Proto-Oncogene Proteins c-fos Human genes 0.000 description 1
- 108010071563 Proto-Oncogene Proteins c-fos Proteins 0.000 description 1
- 241000589516 Pseudomonas Species 0.000 description 1
- LCTONWCANYUPML-UHFFFAOYSA-M Pyruvate Chemical compound CC(=O)C([O-])=O LCTONWCANYUPML-UHFFFAOYSA-M 0.000 description 1
- 108010011939 Pyruvate Decarboxylase Proteins 0.000 description 1
- 102000013009 Pyruvate Kinase Human genes 0.000 description 1
- 108020005115 Pyruvate Kinase Proteins 0.000 description 1
- 102100026067 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial Human genes 0.000 description 1
- 108090000944 RNA Helicases Proteins 0.000 description 1
- 102000004409 RNA Helicases Human genes 0.000 description 1
- 102000015097 RNA Splicing Factors Human genes 0.000 description 1
- 108010039259 RNA Splicing Factors Proteins 0.000 description 1
- 239000013614 RNA sample Substances 0.000 description 1
- 102000044126 RNA-Binding Proteins Human genes 0.000 description 1
- 230000004570 RNA-binding Effects 0.000 description 1
- 102100040028 RNA-binding motif protein, X-linked 2 Human genes 0.000 description 1
- 101710105008 RNA-binding protein Proteins 0.000 description 1
- 238000010240 RT-PCR analysis Methods 0.000 description 1
- 102100035582 Ral-GDS-related protein Human genes 0.000 description 1
- 102100033100 Ras-related protein Rab-7L1 Human genes 0.000 description 1
- 102100025234 Receptor of activated protein C kinase 1 Human genes 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 1
- 206010038111 Recurrent cancer Diseases 0.000 description 1
- 206010070308 Refractory cancer Diseases 0.000 description 1
- 102100037421 Regulator of G-protein signaling 5 Human genes 0.000 description 1
- 102000005945 Regulatory Factor X1 Human genes 0.000 description 1
- 108010030933 Regulatory Factor X1 Proteins 0.000 description 1
- 101710144539 Replication protein A 14 kDa subunit Proteins 0.000 description 1
- 102100035729 Replication protein A 70 kDa DNA-binding subunit Human genes 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 102100038042 Retinoblastoma-associated protein Human genes 0.000 description 1
- 102100034253 Retinoic acid receptor RXR-beta Human genes 0.000 description 1
- 102000002278 Ribosomal Proteins Human genes 0.000 description 1
- 108010000605 Ribosomal Proteins Proteins 0.000 description 1
- 102100022213 Ribosome quality control complex subunit NEMF Human genes 0.000 description 1
- 206010039281 Rubinstein-Taybi syndrome Diseases 0.000 description 1
- 230000018199 S phase Effects 0.000 description 1
- 102100035914 S-adenosylmethionine decarboxylase proenzyme Human genes 0.000 description 1
- 108010005173 SERPIN-B5 Proteins 0.000 description 1
- 108091006734 SLC22A3 Proteins 0.000 description 1
- 102100037599 SPARC Human genes 0.000 description 1
- 102100023010 SRSF protein kinase 1 Human genes 0.000 description 1
- 101710190452 SRSF protein kinase 1 Proteins 0.000 description 1
- 101150112625 SSN3 gene Proteins 0.000 description 1
- 101150073222 SSN8 gene Proteins 0.000 description 1
- 108010044012 STAT1 Transcription Factor Proteins 0.000 description 1
- 102000004265 STAT2 Transcription Factor Human genes 0.000 description 1
- 108010081691 STAT2 Transcription Factor Proteins 0.000 description 1
- 108010017324 STAT3 Transcription Factor Proteins 0.000 description 1
- 102000005886 STAT4 Transcription Factor Human genes 0.000 description 1
- 108010019992 STAT4 Transcription Factor Proteins 0.000 description 1
- 108010011005 STAT6 Transcription Factor Proteins 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 101100450139 Schizosaccharomyces pombe (strain 972 / ATCC 24843) mis16 gene Proteins 0.000 description 1
- 101100150415 Schizosaccharomyces pombe (strain 972 / ATCC 24843) srb10 gene Proteins 0.000 description 1
- 101100150266 Schizosaccharomyces pombe (strain 972 / ATCC 24843) srb11 gene Proteins 0.000 description 1
- 101100071627 Schizosaccharomyces pombe (strain 972 / ATCC 24843) swo1 gene Proteins 0.000 description 1
- 102400001107 Secretory component Human genes 0.000 description 1
- 102000040739 Secretory proteins Human genes 0.000 description 1
- 108091058545 Secretory proteins Proteins 0.000 description 1
- BUGBHKTXTAQXES-UHFFFAOYSA-N Selenium Chemical compound [Se] BUGBHKTXTAQXES-UHFFFAOYSA-N 0.000 description 1
- 102100037550 Semenogelin-1 Human genes 0.000 description 1
- 101710089345 Semenogelin-1 Proteins 0.000 description 1
- 102100037547 Semenogelin-2 Human genes 0.000 description 1
- 101710089335 Semenogelin-2 Proteins 0.000 description 1
- 102000015338 Seminal Plasma Proteins Human genes 0.000 description 1
- 108010064603 Seminal Plasma Proteins Proteins 0.000 description 1
- 206010070834 Sensitisation Diseases 0.000 description 1
- 102100028024 Septin-9 Human genes 0.000 description 1
- ZUGXSSFMTXKHJS-ZLUOBGJFSA-N Ser-Ala-Ala Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(O)=O ZUGXSSFMTXKHJS-ZLUOBGJFSA-N 0.000 description 1
- JPIDMRXXNMIVKY-VZFHVOOUSA-N Ser-Ala-Thr Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](C)C(=O)N[C@@H]([C@@H](C)O)C(O)=O JPIDMRXXNMIVKY-VZFHVOOUSA-N 0.000 description 1
- QEDMOZUJTGEIBF-FXQIFTODSA-N Ser-Arg-Asp Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(O)=O QEDMOZUJTGEIBF-FXQIFTODSA-N 0.000 description 1
- VQBLHWSPVYYZTB-DCAQKATOSA-N Ser-Arg-His Chemical compound C1=C(NC=N1)C[C@@H](C(=O)O)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CO)N VQBLHWSPVYYZTB-DCAQKATOSA-N 0.000 description 1
- QGMLKFGTGXWAHF-IHRRRGAJSA-N Ser-Arg-Phe Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC1=CC=CC=C1)C(O)=O QGMLKFGTGXWAHF-IHRRRGAJSA-N 0.000 description 1
- XWCYBVBLJRWOFR-WDSKDSINSA-N Ser-Gln-Gly Chemical compound OC[C@H](N)C(=O)N[C@@H](CCC(N)=O)C(=O)NCC(O)=O XWCYBVBLJRWOFR-WDSKDSINSA-N 0.000 description 1
- YRBGKVIWMNEVCZ-WDSKDSINSA-N Ser-Glu-Gly Chemical compound OC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(O)=O YRBGKVIWMNEVCZ-WDSKDSINSA-N 0.000 description 1
- OHKFXGKHSJKKAL-NRPADANISA-N Ser-Glu-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C(C)C)C(O)=O OHKFXGKHSJKKAL-NRPADANISA-N 0.000 description 1
- BPMRXBZYPGYPJN-WHFBIAKZSA-N Ser-Gly-Asn Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(O)=O BPMRXBZYPGYPJN-WHFBIAKZSA-N 0.000 description 1
- YMTLKLXDFCSCNX-BYPYZUCNSA-N Ser-Gly-Gly Chemical compound OC[C@H](N)C(=O)NCC(=O)NCC(O)=O YMTLKLXDFCSCNX-BYPYZUCNSA-N 0.000 description 1
- IOVHBRCQOGWAQH-ZKWXMUAHSA-N Ser-Gly-Ile Chemical compound [H]N[C@@H](CO)C(=O)NCC(=O)N[C@@H]([C@@H](C)CC)C(O)=O IOVHBRCQOGWAQH-ZKWXMUAHSA-N 0.000 description 1
- KDGARKCAKHBEDB-NKWVEPMBSA-N Ser-Gly-Pro Chemical compound C1C[C@@H](N(C1)C(=O)CNC(=O)[C@H](CO)N)C(=O)O KDGARKCAKHBEDB-NKWVEPMBSA-N 0.000 description 1
- VMLONWHIORGALA-SRVKXCTJSA-N Ser-Leu-Leu Chemical compound CC(C)C[C@@H](C([O-])=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H]([NH3+])CO VMLONWHIORGALA-SRVKXCTJSA-N 0.000 description 1
- GVMUJUPXFQFBBZ-GUBZILKMSA-N Ser-Lys-Glu Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(O)=O GVMUJUPXFQFBBZ-GUBZILKMSA-N 0.000 description 1
- KZPRPBLHYMZIMH-MXAVVETBSA-N Ser-Phe-Ile Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CC=CC=C1)C(=O)N[C@@H]([C@@H](C)CC)C(O)=O KZPRPBLHYMZIMH-MXAVVETBSA-N 0.000 description 1
- WLJPJRGQRNCIQS-ZLUOBGJFSA-N Ser-Ser-Asn Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(O)=O WLJPJRGQRNCIQS-ZLUOBGJFSA-N 0.000 description 1
- GYDFRTRSSXOZCR-ACZMJKKPSA-N Ser-Ser-Glu Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)N[C@H](C(O)=O)CCC(O)=O GYDFRTRSSXOZCR-ACZMJKKPSA-N 0.000 description 1
- SOACHCFYJMCMHC-BWBBJGPYSA-N Ser-Thr-Cys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CS)C(=O)O)NC(=O)[C@H](CO)N)O SOACHCFYJMCMHC-BWBBJGPYSA-N 0.000 description 1
- BDMWLJLPPUCLNV-XGEHTFHBSA-N Ser-Thr-Val Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(O)=O BDMWLJLPPUCLNV-XGEHTFHBSA-N 0.000 description 1
- 102000012479 Serine Proteases Human genes 0.000 description 1
- 108010022999 Serine Proteases Proteins 0.000 description 1
- 102100037628 Serine/threonine-protein kinase 3 Human genes 0.000 description 1
- 102100028904 Serine/threonine-protein kinase MARK2 Human genes 0.000 description 1
- 102100030333 Serpin B5 Human genes 0.000 description 1
- 102100029904 Signal transducer and activator of transcription 1-alpha/beta Human genes 0.000 description 1
- 102100024040 Signal transducer and activator of transcription 3 Human genes 0.000 description 1
- 102100023980 Signal transducer and activator of transcription 6 Human genes 0.000 description 1
- 102100029215 Signaling lymphocytic activation molecule Human genes 0.000 description 1
- 101710163413 Signaling lymphocytic activation molecule Proteins 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 101710155392 Small nuclear ribonucleoprotein E Proteins 0.000 description 1
- 108700036982 Small nuclear ribonucleoprotein G Proteins 0.000 description 1
- 102100038685 Small nuclear ribonucleoprotein Sm D2 Human genes 0.000 description 1
- 102100028844 Sodium/potassium-transporting ATPase subunit beta-1 Human genes 0.000 description 1
- 102100036929 Solute carrier family 22 member 3 Human genes 0.000 description 1
- 102100026901 Sorbin and SH3 domain-containing protein 2 Human genes 0.000 description 1
- 102100036428 Spondin-1 Human genes 0.000 description 1
- 102100036427 Spondin-2 Human genes 0.000 description 1
- 101710092169 Spondin-2 Proteins 0.000 description 1
- 241000269319 Squalius cephalus Species 0.000 description 1
- 241000191940 Staphylococcus Species 0.000 description 1
- 108091081024 Start codon Proteins 0.000 description 1
- 102000001854 Steroid 17-alpha-Hydroxylase Human genes 0.000 description 1
- 108010015330 Steroid 17-alpha-Hydroxylase Proteins 0.000 description 1
- 108010085012 Steroid Receptors Proteins 0.000 description 1
- 229930182558 Sterol Natural products 0.000 description 1
- 108010020396 Sterol Regulatory Element Binding Proteins Proteins 0.000 description 1
- 102000009822 Sterol Regulatory Element Binding Proteins Human genes 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- 102100027918 Sucrase-isomaltase, intestinal Human genes 0.000 description 1
- 102100034371 Sulfhydryl oxidase 1 Human genes 0.000 description 1
- 101710159725 Sulfhydryl oxidase 1 Proteins 0.000 description 1
- 108700027336 Suppressor of Cytokine Signaling 1 Proteins 0.000 description 1
- 102100024779 Suppressor of cytokine signaling 1 Human genes 0.000 description 1
- 102100024784 Suppressor of cytokine signaling 2 Human genes 0.000 description 1
- 102100024283 Suppressor of cytokine signaling 3 Human genes 0.000 description 1
- 102100030530 Suppressor of cytokine signaling 6 Human genes 0.000 description 1
- 102100030545 Synaptosomal-associated protein 23 Human genes 0.000 description 1
- 108091008874 T cell receptors Proteins 0.000 description 1
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- 102100028866 TATA element modulatory factor Human genes 0.000 description 1
- 108091005735 TGF-beta receptors Proteins 0.000 description 1
- 108010083809 Talin Proteins 0.000 description 1
- 102000006463 Talin Human genes 0.000 description 1
- 102100038126 Tenascin Human genes 0.000 description 1
- 102100038977 Testis-specific basic protein Y 1 Human genes 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 102000002933 Thioredoxin Human genes 0.000 description 1
- 102100031373 Thioredoxin-like protein 1 Human genes 0.000 description 1
- CEXFELBFVHLYDZ-XGEHTFHBSA-N Thr-Arg-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(O)=O CEXFELBFVHLYDZ-XGEHTFHBSA-N 0.000 description 1
- VXMHQKHDKCATDV-VEVYYDQMSA-N Thr-Asp-Arg Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O VXMHQKHDKCATDV-VEVYYDQMSA-N 0.000 description 1
- WBCCCPZIJIJTSD-TUBUOCAGSA-N Thr-His-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CC1=CN=CN1)NC(=O)[C@H]([C@@H](C)O)N WBCCCPZIJIJTSD-TUBUOCAGSA-N 0.000 description 1
- FQPDRTDDEZXCEC-SVSWQMSJSA-N Thr-Ile-Ser Chemical compound [H]N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(O)=O FQPDRTDDEZXCEC-SVSWQMSJSA-N 0.000 description 1
- XYFISNXATOERFZ-OSUNSFLBSA-N Thr-Ile-Val Chemical compound CC[C@H](C)[C@@H](C(=O)N[C@@H](C(C)C)C(=O)O)NC(=O)[C@H]([C@@H](C)O)N XYFISNXATOERFZ-OSUNSFLBSA-N 0.000 description 1
- DIHPMRTXPYMDJZ-KAOXEZKKSA-N Thr-Tyr-Pro Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC1=CC=C(C=C1)O)C(=O)N2CCC[C@@H]2C(=O)O)N)O DIHPMRTXPYMDJZ-KAOXEZKKSA-N 0.000 description 1
- CYCGARJWIQWPQM-YJRXYDGGSA-N Thr-Tyr-Ser Chemical compound C[C@@H](O)[C@H]([NH3+])C(=O)N[C@H](C(=O)N[C@@H](CO)C([O-])=O)CC1=CC=C(O)C=C1 CYCGARJWIQWPQM-YJRXYDGGSA-N 0.000 description 1
- 102100029689 Thyroid hormone receptor-associated protein 3 Human genes 0.000 description 1
- AUYYCJSJGJYCDS-LBPRGKRZSA-N Thyrolar Chemical class IC1=CC(C[C@H](N)C(O)=O)=CC(I)=C1OC1=CC=C(O)C(I)=C1 AUYYCJSJGJYCDS-LBPRGKRZSA-N 0.000 description 1
- 102100040423 Transcobalamin-2 Human genes 0.000 description 1
- 230000010632 Transcription Factor Activity Effects 0.000 description 1
- 102100031027 Transcription activator BRG1 Human genes 0.000 description 1
- 102100030836 Transcriptional adapter 3 Human genes 0.000 description 1
- 102000016715 Transforming Growth Factor beta Receptors Human genes 0.000 description 1
- 102000046299 Transforming Growth Factor beta1 Human genes 0.000 description 1
- 101800002279 Transforming growth factor beta-1 Proteins 0.000 description 1
- 102100030742 Transforming growth factor beta-1 proprotein Human genes 0.000 description 1
- 102100033459 Transforming growth factor beta-1-induced transcript 1 protein Human genes 0.000 description 1
- 102100022387 Transforming protein RhoA Human genes 0.000 description 1
- 108060008539 Transglutaminase Proteins 0.000 description 1
- 102100032834 Translin-associated protein X Human genes 0.000 description 1
- 101710198109 Translin-associated protein X Proteins 0.000 description 1
- 102100022243 Transmembrane emp24 domain-containing protein 1 Human genes 0.000 description 1
- 102100022075 Transmembrane protein 59 Human genes 0.000 description 1
- 102000005924 Triose-Phosphate Isomerase Human genes 0.000 description 1
- 108700015934 Triose-phosphate isomerases Proteins 0.000 description 1
- 108010030743 Tropomyosin Proteins 0.000 description 1
- 102000005937 Tropomyosin Human genes 0.000 description 1
- OJKVFAWXPGCJMF-BPUTZDHNSA-N Trp-Pro-Ser Chemical compound C1C[C@H](N(C1)C(=O)[C@H](CC2=CNC3=CC=CC=C32)N)C(=O)N[C@@H](CO)C(=O)O OJKVFAWXPGCJMF-BPUTZDHNSA-N 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 102100031638 Tuberin Human genes 0.000 description 1
- 108050009309 Tuberin Proteins 0.000 description 1
- 102000004243 Tubulin Human genes 0.000 description 1
- 108090000704 Tubulin Proteins 0.000 description 1
- 108010078814 Tumor Suppressor Protein p53 Proteins 0.000 description 1
- OOEUVMFKKZYSRX-LEWSCRJBSA-N Tyr-Ala-Pro Chemical compound C[C@@H](C(=O)N1CCC[C@@H]1C(=O)O)NC(=O)[C@H](CC2=CC=C(C=C2)O)N OOEUVMFKKZYSRX-LEWSCRJBSA-N 0.000 description 1
- RYSNTWVRSLCAJZ-RYUDHWBXSA-N Tyr-Gln-Gly Chemical compound OC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 RYSNTWVRSLCAJZ-RYUDHWBXSA-N 0.000 description 1
- AZGZDDNKFFUDEH-QWRGUYRKSA-N Tyr-Gly-Ser Chemical compound OC[C@@H](C(O)=O)NC(=O)CNC(=O)[C@@H](N)CC1=CC=C(O)C=C1 AZGZDDNKFFUDEH-QWRGUYRKSA-N 0.000 description 1
- NKUGCYDFQKFVOJ-JYJNAYRXSA-N Tyr-Leu-Gln Chemical compound NC(=O)CC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CC1=CC=C(O)C=C1 NKUGCYDFQKFVOJ-JYJNAYRXSA-N 0.000 description 1
- PMHLLBKTDHQMCY-ULQDDVLXSA-N Tyr-Lys-Val Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(O)=O PMHLLBKTDHQMCY-ULQDDVLXSA-N 0.000 description 1
- QFXVAFIHVWXXBJ-AVGNSLFASA-N Tyr-Ser-Glu Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCC(O)=O)C(O)=O QFXVAFIHVWXXBJ-AVGNSLFASA-N 0.000 description 1
- ZPFLBLFITJCBTP-QWRGUYRKSA-N Tyr-Ser-Gly Chemical compound [H]N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CO)C(=O)NCC(O)=O ZPFLBLFITJCBTP-QWRGUYRKSA-N 0.000 description 1
- HSCJRCZFDFQWRP-JZMIEXBBSA-N UDP-alpha-D-glucose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 HSCJRCZFDFQWRP-JZMIEXBBSA-N 0.000 description 1
- 102100029633 UDP-glucuronosyltransferase 2B15 Human genes 0.000 description 1
- 101710200683 UDP-glucuronosyltransferase 2B15 Proteins 0.000 description 1
- 102100040373 UDP-glucuronosyltransferase 2B17 Human genes 0.000 description 1
- 101710200687 UDP-glucuronosyltransferase 2B17 Proteins 0.000 description 1
- 102100029819 UDP-glucuronosyltransferase 2B7 Human genes 0.000 description 1
- 101710172645 UDP-glycosyltransferase 2 Proteins 0.000 description 1
- 101710119791 Ubiquitin-conjugating enzyme E2 variant 1 Proteins 0.000 description 1
- 102100030434 Ubiquitin-protein ligase E3A Human genes 0.000 description 1
- HSCJRCZFDFQWRP-UHFFFAOYSA-N Uridindiphosphoglukose Natural products OC1C(O)C(O)C(CO)OC1OP(O)(=O)OP(O)(=O)OCC1C(O)C(O)C(N2C(NC(=O)C=C2)=O)O1 HSCJRCZFDFQWRP-UHFFFAOYSA-N 0.000 description 1
- LHADRQBREKTRLR-DCAQKATOSA-N Val-Cys-Leu Chemical compound CC(C)C[C@@H](C(=O)O)NC(=O)[C@H](CS)NC(=O)[C@H](C(C)C)N LHADRQBREKTRLR-DCAQKATOSA-N 0.000 description 1
- CPTQYHDSVGVGDZ-UKJIMTQDSA-N Val-Gln-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](CCC(=O)N)NC(=O)[C@H](C(C)C)N CPTQYHDSVGVGDZ-UKJIMTQDSA-N 0.000 description 1
- UKEVLVBHRKWECS-LSJOCFKGSA-N Val-Ile-Gly Chemical compound CC[C@H](C)[C@@H](C(=O)NCC(=O)O)NC(=O)[C@H](C(C)C)N UKEVLVBHRKWECS-LSJOCFKGSA-N 0.000 description 1
- WHVSJHJTMUHYBT-SRVKXCTJSA-N Val-Met-Met Chemical compound CC(C)[C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCSC)C(=O)O)N WHVSJHJTMUHYBT-SRVKXCTJSA-N 0.000 description 1
- QPJSIBAOZBVELU-BPNCWPANSA-N Val-Tyr-Ala Chemical compound C[C@@H](C(=O)O)NC(=O)[C@H](CC1=CC=C(C=C1)O)NC(=O)[C@H](C(C)C)N QPJSIBAOZBVELU-BPNCWPANSA-N 0.000 description 1
- WBPFYNYTYASCQP-CYDGBPFRSA-N Val-Val-Ile Chemical compound CC[C@H](C)[C@@H](C(=O)O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)C)N WBPFYNYTYASCQP-CYDGBPFRSA-N 0.000 description 1
- JVGDAEKKZKKZFO-RCWTZXSCSA-N Val-Val-Thr Chemical compound C[C@H]([C@@H](C(=O)O)NC(=O)[C@H](C(C)C)NC(=O)[C@H](C(C)C)N)O JVGDAEKKZKKZFO-RCWTZXSCSA-N 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 108700005077 Viral Genes Proteins 0.000 description 1
- 101710101493 Viral myc transforming protein Proteins 0.000 description 1
- 229930003316 Vitamin D Natural products 0.000 description 1
- QYSXJUFSXHHAJI-XFEUOLMDSA-N Vitamin D3 Natural products C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C/C=C1\C[C@@H](O)CCC1=C QYSXJUFSXHHAJI-XFEUOLMDSA-N 0.000 description 1
- 102100037803 Voltage-dependent anion-selective channel protein 2 Human genes 0.000 description 1
- 108050001640 Voltage-dependent anion-selective channel protein 2 Proteins 0.000 description 1
- IXKSXJFAGXLQOQ-XISFHERQSA-N WHWLQLKPGQPMY Chemical compound C([C@@H](C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(O)=O)NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)C1=CNC=N1 IXKSXJFAGXLQOQ-XISFHERQSA-N 0.000 description 1
- 108091007416 X-inactive specific transcript Proteins 0.000 description 1
- 108091035715 XIST (gene) Proteins 0.000 description 1
- 101000707286 Xenopus laevis Protein Shroom1 Proteins 0.000 description 1
- 102100040314 Zinc finger and BTB domain-containing protein 16 Human genes 0.000 description 1
- 102100028131 Zinc finger and BTB domain-containing protein 43 Human genes 0.000 description 1
- 102100026624 Zinc finger and SCAN domain-containing protein 9 Human genes 0.000 description 1
- 102100030619 Zinc finger transcription factor Trps1 Human genes 0.000 description 1
- 108091007916 Zinc finger transcription factors Proteins 0.000 description 1
- 102000038627 Zinc finger transcription factors Human genes 0.000 description 1
- XJLXINKUBYWONI-DQQFMEOOSA-N [[(2r,3r,4r,5r)-5-(6-aminopurin-9-yl)-3-hydroxy-4-phosphonooxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(2s,3r,4s,5s)-5-(3-carbamoylpyridin-1-ium-1-yl)-3,4-dihydroxyoxolan-2-yl]methyl phosphate Chemical compound NC(=O)C1=CC=C[N+]([C@@H]2[C@H]([C@@H](O)[C@H](COP([O-])(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](OP(O)(O)=O)[C@@H](O3)N3C4=NC=NC(N)=C4N=C3)O)O2)O)=C1 XJLXINKUBYWONI-DQQFMEOOSA-N 0.000 description 1
- ZUPXXZAVUHFCNV-UHFFFAOYSA-N [[5-(6-aminopurin-9-yl)-3,4-dihydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [5-(3-carbamoyl-4h-pyridin-1-yl)-3,4-dihydroxyoxolan-2-yl]methyl hydrogen phosphate;potassium Chemical compound [K].C1=CCC(C(=O)N)=CN1C1C(O)C(O)C(COP(O)(=O)OP(O)(=O)OCC2C(C(O)C(O2)N2C3=NC=NC(N)=C3N=C2)O)O1 ZUPXXZAVUHFCNV-UHFFFAOYSA-N 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 102000035181 adaptor proteins Human genes 0.000 description 1
- 108091005764 adaptor proteins Proteins 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 208000009956 adenocarcinoma Diseases 0.000 description 1
- 102000030621 adenylate cyclase Human genes 0.000 description 1
- 108060000200 adenylate cyclase Proteins 0.000 description 1
- 108010066695 adenylate kinase 1 Proteins 0.000 description 1
- 230000001919 adrenal effect Effects 0.000 description 1
- 210000004100 adrenal gland Anatomy 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 108010044940 alanylglutamine Proteins 0.000 description 1
- 108010091628 alpha 1-Antichymotrypsin Proteins 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 238000004873 anchoring Methods 0.000 description 1
- 238000009167 androgen deprivation therapy Methods 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000003957 anion exchange resin Substances 0.000 description 1
- 229940045799 anthracyclines and related substance Drugs 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940030495 antiandrogen sex hormone and modulator of the genital system Drugs 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 108010013835 arginine glutamate Proteins 0.000 description 1
- 108010069926 arginyl-glycyl-serine Proteins 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 108010047857 aspartylglycine Proteins 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 230000001651 autotrophic effect Effects 0.000 description 1
- 230000006399 behavior Effects 0.000 description 1
- XMQFTWRPUQYINF-UHFFFAOYSA-N bensulfuron-methyl Chemical compound COC(=O)C1=CC=CC=C1CS(=O)(=O)NC(=O)NC1=NC(OC)=CC(OC)=N1 XMQFTWRPUQYINF-UHFFFAOYSA-N 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- 108010057005 beta-galactoside alpha-2,3-sialyltransferase Proteins 0.000 description 1
- 102000006635 beta-lactamase Human genes 0.000 description 1
- 108010020169 beta-microseminoprotein Proteins 0.000 description 1
- 238000002306 biochemical method Methods 0.000 description 1
- 230000008238 biochemical pathway Effects 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000002715 bioenergetic effect Effects 0.000 description 1
- 230000008436 biogenesis Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 201000010983 breast ductal carcinoma Diseases 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- GMRQFYUYWCNGIN-NKMMMXOESA-N calcitriol Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@@H](CCCC(C)(C)O)C)=C\C=C1\C[C@@H](O)C[C@H](O)C1=C GMRQFYUYWCNGIN-NKMMMXOESA-N 0.000 description 1
- 229960005084 calcitriol Drugs 0.000 description 1
- 238000004422 calculation algorithm Methods 0.000 description 1
- 229940041514 candida albicans extract Drugs 0.000 description 1
- 210000000692 cap cell Anatomy 0.000 description 1
- 125000002057 carboxymethyl group Chemical group [H]OC(=O)C([H])([H])[*] 0.000 description 1
- 238000005341 cation exchange Methods 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000011712 cell development Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000015861 cell surface binding Effects 0.000 description 1
- 230000010307 cell transformation Effects 0.000 description 1
- 230000006567 cellular energy metabolism Effects 0.000 description 1
- 230000033077 cellular process Effects 0.000 description 1
- 230000004715 cellular signal transduction Effects 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 230000001876 chaperonelike Effects 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000011098 chromatofocusing Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000012504 chromatography matrix Substances 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 230000014107 chromosome localization Effects 0.000 description 1
- 108060001643 clathrin heavy chain Proteins 0.000 description 1
- 102000014907 clathrin heavy chain Human genes 0.000 description 1
- RAURUSFBVQLAPW-DNIKMYEQSA-N clocinnamox Chemical compound N1([C@@H]2CC3=CC=C(C=4O[C@@H]5[C@](C3=4)([C@]2(CCC5=O)NC(=O)\C=C\C=2C=CC(Cl)=CC=2)CC1)O)CC1CC1 RAURUSFBVQLAPW-DNIKMYEQSA-N 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 230000004154 complement system Effects 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 108091036078 conserved sequence Proteins 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 108010069495 cysteinyltyrosine Proteins 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 230000003436 cytoskeletal effect Effects 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 230000002074 deregulated effect Effects 0.000 description 1
- 210000005045 desmin Anatomy 0.000 description 1
- 238000002405 diagnostic procedure Methods 0.000 description 1
- 238000010586 diagram Methods 0.000 description 1
- AAOVKJBEBIDNHE-UHFFFAOYSA-N diazepam Chemical compound N=1CC(=O)N(C)C2=CC=C(Cl)C=C2C=1C1=CC=CC=C1 AAOVKJBEBIDNHE-UHFFFAOYSA-N 0.000 description 1
- 229960003529 diazepam Drugs 0.000 description 1
- 108091009709 diazepam binding proteins Proteins 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- QONQRTHLHBTMGP-UHFFFAOYSA-N digitoxigenin Natural products CC12CCC(C3(CCC(O)CC3CC3)C)C3C11OC1CC2C1=CC(=O)OC1 QONQRTHLHBTMGP-UHFFFAOYSA-N 0.000 description 1
- SHIBSTMRCDJXLN-KCZCNTNESA-N digoxigenin Chemical compound C1([C@@H]2[C@@]3([C@@](CC2)(O)[C@H]2[C@@H]([C@@]4(C)CC[C@H](O)C[C@H]4CC2)C[C@H]3O)C)=CC(=O)OC1 SHIBSTMRCDJXLN-KCZCNTNESA-N 0.000 description 1
- VLYUGYAKYZETRF-UHFFFAOYSA-N dihydrolipoamide Chemical compound NC(=O)CCCCC(S)CCS VLYUGYAKYZETRF-UHFFFAOYSA-N 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- 101150115114 dnaJ gene Proteins 0.000 description 1
- 101150052825 dnaK gene Proteins 0.000 description 1
- 230000027721 electron transport chain Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000012149 elution buffer Substances 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 230000003511 endothelial effect Effects 0.000 description 1
- 230000006862 enzymatic digestion Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 238000001976 enzyme digestion Methods 0.000 description 1
- 229940116977 epidermal growth factor Drugs 0.000 description 1
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 1
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 1
- 230000008556 epithelial cell proliferation Effects 0.000 description 1
- 230000009786 epithelial differentiation Effects 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 229960005420 etoposide Drugs 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 108010055671 ezrin Proteins 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 210000002458 fetal heart Anatomy 0.000 description 1
- 239000012847 fine chemical Substances 0.000 description 1
- 238000010230 functional analysis Methods 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 230000009395 genetic defect Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 230000000762 glandular Effects 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 108010092115 glutamyl-prolyl-tRNA synthetase Proteins 0.000 description 1
- 102000006602 glyceraldehyde-3-phosphate dehydrogenase Human genes 0.000 description 1
- 230000002414 glycolytic effect Effects 0.000 description 1
- 102000040409 glycosyltransferase 2 family Human genes 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 108010051307 glycyl-glycyl-proline Proteins 0.000 description 1
- 108010089804 glycyl-threonine Proteins 0.000 description 1
- 108010020688 glycylhistidine Proteins 0.000 description 1
- 108010070387 guanylate cyclase 1 Proteins 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 210000001320 hippocampus Anatomy 0.000 description 1
- 108010085325 histidylproline Proteins 0.000 description 1
- 108010018006 histidylserine Proteins 0.000 description 1
- 102000046818 human AR Human genes 0.000 description 1
- 102000056909 human ARF4 Human genes 0.000 description 1
- 102000055021 human ARG2 Human genes 0.000 description 1
- 102000046732 human DDX50 Human genes 0.000 description 1
- 102000046689 human FOLH1 Human genes 0.000 description 1
- 102000057620 human FOXA1 Human genes 0.000 description 1
- 102000052139 human HOXB13 Human genes 0.000 description 1
- 102000051270 human MAGEA6 Human genes 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- GRRNUXAQVGOGFE-NZSRVPFOSA-N hygromycin B Chemical compound O[C@@H]1[C@@H](NC)C[C@@H](N)[C@H](O)[C@H]1O[C@H]1[C@H]2O[C@@]3([C@@H]([C@@H](O)[C@@H](O)[C@@H](C(N)CO)O3)O)O[C@H]2[C@@H](O)[C@@H](CO)O1 GRRNUXAQVGOGFE-NZSRVPFOSA-N 0.000 description 1
- 229940097277 hygromycin b Drugs 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 230000005847 immunogenicity Effects 0.000 description 1
- 238000009169 immunotherapy Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 108091006086 inhibitor proteins Proteins 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 230000000266 injurious effect Effects 0.000 description 1
- 229940125396 insulin Drugs 0.000 description 1
- 102000006495 integrins Human genes 0.000 description 1
- 108010044426 integrins Proteins 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- ODBLHEXUDAPZAU-UHFFFAOYSA-N isocitric acid Chemical compound OC(=O)C(O)C(C(O)=O)CC(O)=O ODBLHEXUDAPZAU-UHFFFAOYSA-N 0.000 description 1
- 108010078274 isoleucylvaline Proteins 0.000 description 1
- 108010024383 kallikrein 4 Proteins 0.000 description 1
- 210000002510 keratinocyte Anatomy 0.000 description 1
- 229940043355 kinase inhibitor Drugs 0.000 description 1
- 239000008101 lactose Substances 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 230000003902 lesion Effects 0.000 description 1
- 108010057821 leucylproline Proteins 0.000 description 1
- 208000032839 leukemia Diseases 0.000 description 1
- 108020001756 ligand binding domains Proteins 0.000 description 1
- 230000037356 lipid metabolism Effects 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 108010040838 lymphocyte-specific protein p50 Proteins 0.000 description 1
- 230000002132 lysosomal effect Effects 0.000 description 1
- 108010003700 lysyl aspartic acid Proteins 0.000 description 1
- 108010064235 lysylglycine Proteins 0.000 description 1
- 238000010841 mRNA extraction Methods 0.000 description 1
- 230000014759 maintenance of location Effects 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 230000010436 membrane biogenesis Effects 0.000 description 1
- 239000002207 metabolite Substances 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 208000011645 metastatic carcinoma Diseases 0.000 description 1
- 208000010658 metastatic prostate carcinoma Diseases 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 108010056582 methionylglutamic acid Proteins 0.000 description 1
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000004005 microsphere Substances 0.000 description 1
- 210000004688 microtubule Anatomy 0.000 description 1
- 239000002395 mineralocorticoid Substances 0.000 description 1
- 210000003470 mitochondria Anatomy 0.000 description 1
- 210000001700 mitochondrial membrane Anatomy 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000007479 molecular analysis Methods 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 210000000066 myeloid cell Anatomy 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 210000003098 myoblast Anatomy 0.000 description 1
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 1
- 230000035407 negative regulation of cell proliferation Effects 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 101150059368 nep gene Proteins 0.000 description 1
- 230000003448 neutrophilic effect Effects 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 210000004492 nuclear pore Anatomy 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002246 oncogenic effect Effects 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 210000001672 ovary Anatomy 0.000 description 1
- 230000010627 oxidative phosphorylation Effects 0.000 description 1
- 230000036542 oxidative stress Effects 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 229950009506 penicillinase Drugs 0.000 description 1
- 235000019319 peptone Nutrition 0.000 description 1
- 230000000858 peroxisomal effect Effects 0.000 description 1
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 description 1
- 108010051242 phenylalanylserine Proteins 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 1
- 230000035479 physiological effects, processes and functions Effects 0.000 description 1
- 230000001817 pituitary effect Effects 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229930192033 plastin Natural products 0.000 description 1
- 108010040003 polyglutamine Proteins 0.000 description 1
- 229920000155 polyglutamine Polymers 0.000 description 1
- 239000002952 polymeric resin Substances 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000003244 pro-oxidative effect Effects 0.000 description 1
- 108010042121 probasin Proteins 0.000 description 1
- 239000000092 prognostic biomarker Substances 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 108010031719 prolyl-serine Proteins 0.000 description 1
- 108010079317 prolyl-tyrosine Proteins 0.000 description 1
- 108010070643 prolylglutamic acid Proteins 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 108010031970 prostasin Proteins 0.000 description 1
- 201000005825 prostate adenocarcinoma Diseases 0.000 description 1
- 108020003519 protein disulfide isomerase Proteins 0.000 description 1
- 230000012846 protein folding Effects 0.000 description 1
- 239000012268 protein inhibitor Substances 0.000 description 1
- 229940121649 protein inhibitor Drugs 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 238000001243 protein synthesis Methods 0.000 description 1
- 108020000494 protein-tyrosine phosphatase Proteins 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 239000012264 purified product Substances 0.000 description 1
- 108010015014 pyruvate dehydrogenase E1alpha subunit Proteins 0.000 description 1
- 238000011155 quantitative monitoring Methods 0.000 description 1
- 102000016914 ras Proteins Human genes 0.000 description 1
- 238000011552 rat model Methods 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 238000011084 recovery Methods 0.000 description 1
- 208000016691 refractory malignant neoplasm Diseases 0.000 description 1
- 230000022983 regulation of cell cycle Effects 0.000 description 1
- 238000004153 renaturation Methods 0.000 description 1
- 230000003362 replicative effect Effects 0.000 description 1
- 230000028617 response to DNA damage stimulus Effects 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 150000004492 retinoid derivatives Chemical class 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 108010019034 ribosomal protein L18a Proteins 0.000 description 1
- 102000004314 ribosomal protein S14 Human genes 0.000 description 1
- 108090000850 ribosomal protein S14 Proteins 0.000 description 1
- 239000007320 rich medium Substances 0.000 description 1
- 238000005185 salting out Methods 0.000 description 1
- 208000035926 satellite 3 DNA Diseases 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 229910052711 selenium Inorganic materials 0.000 description 1
- 239000011669 selenium Substances 0.000 description 1
- 230000009758 senescence Effects 0.000 description 1
- 230000008313 sensitization Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 239000013605 shuttle vector Substances 0.000 description 1
- 230000037432 silent mutation Effects 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 238000001542 size-exclusion chromatography Methods 0.000 description 1
- ZFMRLFXUPVQYAU-UHFFFAOYSA-N sodium 5-[[4-[4-[(7-amino-1-hydroxy-3-sulfonaphthalen-2-yl)diazenyl]phenyl]phenyl]diazenyl]-2-hydroxybenzoic acid Chemical compound C1=CC(=CC=C1C2=CC=C(C=C2)N=NC3=C(C=C4C=CC(=CC4=C3O)N)S(=O)(=O)O)N=NC5=CC(=C(C=C5)O)C(=O)O.[Na+] ZFMRLFXUPVQYAU-UHFFFAOYSA-N 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 229940063675 spermine Drugs 0.000 description 1
- 108010085346 steroid delta-isomerase Proteins 0.000 description 1
- 102000005969 steroid hormone receptors Human genes 0.000 description 1
- 230000010009 steroidogenesis Effects 0.000 description 1
- 150000003432 sterols Chemical class 0.000 description 1
- 235000003702 sterols Nutrition 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 210000002536 stromal cell Anatomy 0.000 description 1
- 108060007951 sulfatase Proteins 0.000 description 1
- 230000009469 supplementation Effects 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 229920003002 synthetic resin Polymers 0.000 description 1
- 238000012353 t test Methods 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 108060008226 thioredoxin Proteins 0.000 description 1
- 229940094937 thioredoxin Drugs 0.000 description 1
- 239000005495 thyroid hormone Substances 0.000 description 1
- 229940036555 thyroid hormone Drugs 0.000 description 1
- 230000036962 time dependent Effects 0.000 description 1
- 230000005029 transcription elongation Effects 0.000 description 1
- 108010014678 transcription factor TFIIF Proteins 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 108091008023 transcriptional regulators Proteins 0.000 description 1
- 230000037426 transcriptional repression Effects 0.000 description 1
- 230000002463 transducing effect Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 102000003601 transglutaminase Human genes 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- JOPDZQBPOWAEHC-UHFFFAOYSA-H tristrontium;diphosphate Chemical compound [Sr+2].[Sr+2].[Sr+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O JOPDZQBPOWAEHC-UHFFFAOYSA-H 0.000 description 1
- 239000000107 tumor biomarker Substances 0.000 description 1
- 230000005760 tumorsuppression Effects 0.000 description 1
- 229910052721 tungsten Inorganic materials 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 1
- 108010009962 valyltyrosine Proteins 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 235000019166 vitamin D Nutrition 0.000 description 1
- 239000011710 vitamin D Substances 0.000 description 1
- 150000003710 vitamin D derivatives Chemical class 0.000 description 1
- 229940046008 vitamin d Drugs 0.000 description 1
- 239000012138 yeast extract Substances 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
- C07K14/4701—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals not used
- C07K14/4748—Tumour specific antigens; Tumour rejection antigen precursors [TRAP], e.g. MAGE
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
Definitions
- the present invention relates to the quantitative evaluation of gene expression. More particularly, the present invention relates to novel, androgen-regulated nucleic acids, polynucleotide arrays containing these nucleic acids, and methods of using the array in the evaluation of hormone-related cancers, such as prostate cancer.
- Prostate cancer is the most common malignancy in American men and second leading cause of cancer mortality (1).
- Serum-prostate specific antigen (PSA) tests have revolutionized the early detection of CaP (2).
- PSA has revolutionized early detection of prostate cancer, there is still a very high false positive rate.
- the increasing incidence of CaP has translated into wider use of radical prostatectomy as well as other therapies for localized disease (3-5).
- the wide spectrum of biologic behavior (6) exhibited by prostatic neoplasms poses a difficult problem in predicting the clinical course for the individual patient (3-5).
- Traditional prognostic markers such as grade, clinical stage, and pretreatment PSA have limited prognostic value for individual men (3-5).
- a more reliable technique for the evaluation and prognosis of CaP is desirable.
- CGH comparative genomic hybridization
- transcripts that can be analyzed are the major limitation encountered in subtractive hybridization and differential display approaches.
- cDNA microarray approaches can determine expression of a large number of genes in a high throughput manner
- the current limitations of cDNA arrays include the presence of specific arrays used for analyses and the inability to discover novel genes.
- hormone therapy 314
- Androgen ablation can be achieved, for example, by orchiectomy, by the administration of estrogen, or more recently by one of the luteinizing hormone-releasing hormone agonists.
- hormone therapy 314
- Recent clinical trials have demonstrated the efficacy of combining an antiandrogen to orchiectomy or a luteinizing hormone-releasing hormone to block the remaining androgens produced by the adrenal glands.
- ARGs androgen responsive genes
- the present invention relates to the identification and characterization of a novel androgen-regulated gene that exhibits abundant expression in prostate tissue.
- the novel gene has been designated PMEPA1.
- the invention provides the isolated nucleotide sequence of PMEPA1 or fragments thereof and nucleic acid sequences that hybridize to PMEPA1. These sequences have utility, for example, as markers of prostate cancer and other prostate-related diseases, and as targets for therapeutic intervention in prostate cancer and other prostate-related diseases.
- the invention further provides a vector that directs the expression of PMEPA1, and a host cell transfected or transduced with this vector.
- the invention provides a method of detecting prostate cancer cells in a biological sample, for example, by using nucleic acid amplification techniques with primers and probes selected to bind specifically to the PMEPA1 sequence.
- the invention relates to an isolated polypeptide encoded by the PMEPA1 gene or a fragment thereof, and antibodies generated against the PMEPA1 polypeptide, peptides, or portions thereof, which can be used to detect, treat, and prevent prostate cancer.
- the present invention also relates to a polynucleotide array
- a polynucleotide array comprising (a) a planar, non-porous solid support having at least a first surface; and (b) a first set of polynucleotide probes attached to the first surface of the solid support, where the first set of polynuceotide probes comprises polynucleotide sequences derived from genes that are up-regulated, such as PMEPA1, or down-regulated in response to androgen, including genes downstream of the androgen receptor gene and genes upstream of the androgen receptor gene that modulate androgen receptor function.
- the polynucleotides immobilized on the solid support include genes that are known to be involved in testosterone biosynthesis and metabolism.
- the oligonucleotides immobilized on the solid support include genes whose expression is altered in prostate cancer or is specific to prostate tissue.
- the invention provides a method for the diagnosis or prognosis of prostate cancer, comprising (a) hybridizing nucleic acids of a target cell of a patient with a polynucleotide array, as described above, to obtain a first hybridization pattern, where the first hybridization pattern represents an expression profile of androgen-regulated genes in the target cell; (b) comparing the first hybridization pattern of the target cell to a second hybridization pattern, where the second hybridization pattern represents an expression profile of androgen-regulated genes in prostate cancer, and (c) diagnosing or prognosing prostate cancer in the patient.
- a first aspect of the present invention is directed towards a method for analysis of radical prostatectomy specimens for the expression profile of those genes involved in androgen receptor-mediated signaling.
- computer models may be developed for the analysis of expression profiles.
- Another aspect of the invention is directed towards a method of correlating expression profiles with clinico-pathologic features.
- computer models to identify gene expression features associated with tumor phenotypes may be developed.
- Another aspect of the invention is directed towards a method of distinguishing indolent prostate cancers from those with a more aggressive phenotype.
- computer models to such cancers may be developed.
- This invention is further directed to a method of identifying an expression profile of androgen-regulated genes in a target cell, comprising hybridizing the nucleic acids of the target cell with a polynucleotide array, as described above, to obtain a hybridization pattern, where the hybridization pattern represents the expression profile of androgen-regulated genes in the target cell.
- FIG. 1 is a Northern blot showing that PMEPA1 is expressed at high levels in prostate tissue. Multiple tissue northern blots were hybridized with PMEPA1 and GAPDH probes. The arrows indicate the two variants of the PMEPA1 transcript.
- FIG. 2 shows the androgen-dependent expression of PMEPA1.
- FIG. 2A is a Northern blot using PMEPA1 probe with mRNA derived from LNCaP cells with or without R1881 treatment for various durations.
- FIG. 2B is a Northern blot of PMEPA1 expression in primary epithelial cell cultures of normal prostate and prostate and breast cancer cell lines.
- FIG. 3 shows PMEPA1 expression in CwR22 xenograft tumors. Lane 1, sample from CWR22 tumor (androgen dependent). Lanes 2-5, samples from 4 individual CW2R tumors (AR positive but androgen independent).
- the present invention provides a method useful in the diagnosis and prognosis of prostate cancer.
- An aspect of the invention provides a method to identify ARGs, such as PMEPA1, that exhibit stable transcriptional induction/repression in response to androgen and have potential as surrogate markers of the status of the androgen signaling in normal and cancerous epithelial cells of prostate.
- a second aspect of the invention provides for use of the expression profiles resulting from these methods in diagnostic methods, including, but not limited to, characterizing the treatment response to “hormonal therapy,” correlating expression profiles with clinico-pathologic features, distinguishing indolent prostate cancers from those with a more aggressive phenotype, analyzing tumor specimens of patients treated by radical prostate surgery to help define prognosis, screening candidate genes for the development of a polynucleotide array for use as a blood test for improved prostate cancer detection, and identifying androgen regulated genes that may serve as biomarkers for response to treatment to screen drugs for the treatment of advanced prostate cancer.
- arrays may be made in a wide number of variations, combining, probes derived from sequences identified by the inventors as up-regulated or down-regulated in response to androgen and listed in Table 3 (genes and ESTs derived from the inventors' SAGE library that are up-regulated and down-regulated by androgens) with any of the sequences described in Table 4 (candidate genes and ESTs whose expression are potentially prostate specific or restricted), Table 5 (previously described genes and ESTs, including those associated with androgen signaling, prostate specificity, prostate cancer, and nuclear receptors/regulators with potential interaction with androgen receptors), Table 6 (genes and ESTs identified from the NIH CGAP database that are differentially expressed in prostate cancer), Table 7 (androgen regulated genes and ESTs derived from the CPDR Genome Systems ARG Database) and Table 8 (other genes associated with cancers).
- Table 3 genes and ESTs derived from the inventors' SAGE library that are up-regulated and down-regulated by and
- Tables 3-8 are located at the end of the specification at the end of the “Detailed Description” section and before the “References.”
- genes in bold type are known androgen-regulated genes based on Medline Search.
- genes in bold type are known prostate-specific genes.
- Such arrays may be used to detect specific nucleic acid sequences contained in a target cell or sample, as described in U.S. Pat. Nos. 5,744,305, 5,837,832, and 5,861,242, each of which is incorporated herein by reference. More specifically, in the present invention, these arrays may be used in methods for the diagnosis or prognosis of prostate cancer, such as by assessing the expression profiles of genes, derived from biological samples such as blood or tissues, that are up-regulated and down-regulated in response to androgen or otherwise involved in androgen receptor-mediated signaling. In a preferred embodiment, computer models may be developed for the analysis of expression profiles. Moreover, such polynucleotide arrays are useful in methods to screen drugs for the treatment of advanced prostate cancer. In these screening methods, the polynucleotide arrays are used to analyze how drugs affect the expression of androgen-regulated genes that are involved in prostate cancer.
- SAGE analysis The SAGE technology is based on three main principles: 1) A short sequence tag (10-11 bp) is generated that contains sufficient information to identify a transcript, thus, each tag represents a signature sequence of a unique transcript; 2) many transcript tags can be concatenated into a single molecule and then sequenced, revealing the identity of multiple tags simultaneously; 3) quantitation of the number of times a particular tag is observed provides the expression level of the corresponding transcript (30).
- the schematic diagram and the details of SAGE procedure can be obtained from the web site: www.genzyme.com/SAGE.
- SAGE tag defined ARGs were grouped under following categories: transcriptional regulators; RNA processing and translation regulators; protein involved in genomic maintenance and cell cycle; protein trafficking/chaperone proteins; energy metabolism, apoptosis and redox regulators; and signal transducers.
- PubMed database searches a majority of genes listed in FIG. 3 have not been described as androgen regulated before. This is the first comprehensive list of the functionally defined genes regulated by androgen in the context of prostatic epithelial cells.
- a goal of the inventors was to identify highly induced and repressed ARGs in LNCaP model which may define a panel of surrogate markers for the status androgen signaling in normal as well as cancerous prostate.
- ESTs expressed sequence tags
- SAGE tags corresponding to novel transcripts. This is the first report describing a quantitative evaluation of the global gene expression profiles of the ARGs in the context of prostatic cancer cells by SAGE.
- Our study provides quantitative information on about 23,000 transcripts expressed in LNCaP cells, the most common cell line used in prostate cancer research.
- ARGs Utilizing cell-culture systems and cell-signaling agents or exogenous expression of p53 and APC genes, SAGE technology has identified novel physiologically relevant transcriptional target genes which have unraveled new functions of p53 and APC genes (61-64).
- Our analysis of ARGs has provided identification and quantitative assessment of induction or repression of a global expression profile of ARGs in LNCaP cells. ARGs resulting from the mutational defects of the AR and those ARGs unaffected by AR mutations may be identified in this model system. Subsequent androgen regulation analysis of the selected ARGs in AR-positive, primary cultures of normal prostatic epithelial cells, and ARGs expression analysis in normal and tumor tissues will clarify normal or abnormal regulation of these ARGs.
- a panel of highly inducible/repressible ARGs identified by the inventors may provide bio-indicators of the AR transcription factor activity in physiologic context. These AR Function Bio-indicators (ARFBs) are useful in assessing the risk of CaP onset and/or progression. Moreover, identification or ARGs may also help in defining the therapeutic targets which could lead to effective treatment for hormone refractory cancer, currently a frustrating stage of the disease with limited therapeutic options.
- ARFBs AR Function Bio-indicators
- PMEPA1 expression is upregulated by androgens in a time- and concentration-specific manner in LNCaP cells. This observation underscores the potential of measuring PMEPA1 expression as one of the surrogate markers of androgen receptor activity in vivo in the epithelial cells of prostate tissue. Prostate cancer is androgen dependent and its growth in prostate is mediated by a network of ARGs that remains to be fully characterized. Most prostate cancers respond to androgen withdrawal but relapse after the initial response (Koivisto et al., 1998). The growth of the relapsed tumors is androgen independent even though tumors are positive for the expression of the AR (Bentel et al., 1996).
- ARGs including PMEPA1
- ARGs can be used as biomarkers of AR function readout in the subset of prostate cancers that may involve abrogation of androgen signaling.
- the newly defined ARGs have potential to identify novel targets in therapy of hormone refractory prostate cancer.
- nucleic acid molecules encompassed in the invention include the following PMEPA1 nucleotide sequence: ATGGCGGAGC TGGAGTTTGT TCAGATCATC ATCATCGTGG TGGTGATGAT 50 (SEQ ID NO.
- amino acid sequences of the polypeptides encoded by the PMEPA1 nucleotide sequences of the invention include: MAELEFVQII IIVVVMMVMV VVITCLLSHY KLSARSFISR HSQGRRREDA 50 (SEQ ID NO.
- nucleic acids of the invention enable the construction of expression vectors comprising nucleic acid sequences encoding polypeptides; host cells transfected or transformed with the expression vectors; isolated and purified biologically active polypeptides and fragments thereof; the use of the nucleic acids or oligonucleotides thereof as probes to identify nucleic acid encoding proteins having PMEPA1-like activity; the use of single-stranded sense or antisense oligonucleotides from the nucleic acids to inhibit expression of polynucleotides encoded by the PMEPA1 gene; the use of such polypeptides and fragments thereof to generate antibodies; the use of the antibodies to purify PMEPA1 polypeptides; and the use of the nucleic acids, polypeptides, and antibodies of the invention to detect, prevent, and treat prostate cancer (e.g., prostatic intraepithelial neoplasia (PIN), adenocarcinomas, nodular hyperplasia,
- prostate cancer e.g
- nucleotide sequence refers to a polynucleotide molecule in the form of a separate fragment or as a component of a larger nucleic acid construct.
- the nucleic acid molecule has been derived from DNA or RNA isolated at least once in substantially pure form and in a quantity or concentration enabling identification, manipulation, and recovery of its component nucleotide sequences by standard biochemical methods (such as those outlined in (Sambrook et al., Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. (1989)).
- sequences are preferably provided and/or constructed in the form of an open reading frame uninterrupted by internal non-translated sequences, or introns, that are typically present in eukaryotic genes. Sequences of non-translated DNA can be present 5′ or 3′ from an open reading frame, where the same do not interfere with manipulation or expression of the coding region.
- Nucleic acid molecules of the invention include DNA in both single-stranded and double-stranded form, as well as the RNA complement thereof.
- DNA includes, for example, cDNA, genomic DNA, chemically synthesized DNA, DNA amplified by PCR, and combinations thereof.
- Genomic DNA may be isolated by conventional techniques, e.g., using the cDNA of SEQ ID NO: 1, or a suitable fragment thereof, as a probe.
- the DNA molecules of the invention include full length genes as well as polynucleotides and fragments thereof.
- the full length gene may also include the N-terminal signal peptide.
- Other embodiments include DNA encoding a soluble form, e.g., encoding the extracellular domain of the protein, either with or without the signal peptide.
- nucleic acids of the invention are preferentially derived from human sources, but the invention includes those derived from non-human species, as well.
- the particularly preferred nucleotide sequence of the invention is SEQ ID NO:2, as set forth above.
- the sequence of amino acids encoded by the DNA of SEQ ID NO:2 is shown in SEQ ID NO:3.
- a DNA sequence can vary from that shown in SEQ ID NO:2, and still encode a polypeptide having the amino acid sequence of SEQ ID NO:3.
- Such variant DNA sequences can result from silent mutations (e.g., occurring during PCR amplification), or can be the product of deliberate mutagenesis of a native sequence.
- the invention thus provides isolated DNA sequences encoding polypeptides of the invention, selected from: (a) DNA comprising the nucleotide sequence of SEQ ID NO:2; (b) DNA encoding the polypeptide of SEQ ID NO:3; (c) DNA capable of hybridization to a DNA of (a) or (b) under conditions of moderate stringency and which encodes polypeptides of the invention; (d) DNA capable of hybridization to a DNA of (a) or (b) under conditions of high stringency and which encodes polypeptides of the invention, and (e) DNA which is degenerate as a result of the genetic code to a DNA defined in (a), (b), (c), or (d) and which encode polypeptides of the invention.
- polypeptides encoded by such DNA sequences are encompassed by the invention.
- conditions of moderate stringency can be readily determined by those having ordinary skill in the art based on, for example, the length of the DNA.
- the basic conditions are set forth by (Sambrook et al. Molecular Cloning: A Laboratory Manual, 2ed. Vol. 1, pp. 1.101-104, Cold Spring Harbor Laboratory Press, (1989)), and include use of a prewashing solution for the nitrocellulose filters 5 ⁇ SSC, 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridization conditions of about 50% formamide, 6 ⁇ SSC at about 42° C.
- DNA encoding polypeptide fragments and polypeptides comprising inactivated N-glycosylation site(s), inactivated protease processing site(s), or conservative amino acid substitution(s), as described below.
- nucleic acid molecules of the invention also comprise nucleotide sequences that are at least 80% identical to a native sequence. Also contemplated are embodiments in which a nucleic acid molecule comprises a sequence that is at least 90% identical, at least 95% identical, at least 98% identical, at least 99% identical, or at least 99.9% identical to a native sequence.
- the percent identity may be determined by visual inspection and mathematical calculation.
- the percent identity of two nucleic acid sequences can be determined by comparing sequence information using the GAP computer program, version 6.0 described by (Devereux et al., Nucl. Acids Res., 12:387 (1984)) and available from the University of Wisconsin Genetics Computer Group (UWGCG).
- the preferred default parameters for the GAP program include: (1) a unary comparison matrix (containing a value of 1 for identities and 0 for non-identities) for nucleotides, and the weighted comparison matrix of (Gribskov and Burgess. Nucl.
- the invention also provides isolated nucleic acids useful in the production of polypeptides.
- polypeptides may be prepared by any of a number of conventional techniques.
- a DNA sequence encoding a PMEPA1 polypeptide, or desired fragment thereof may be subcloned into an expression vector for production of the polypeptide or fragment.
- the DNA sequence advantageously is fused to a sequence encoding a suitable leader or signal peptide.
- the desired fragment may be chemically synthesized using known techniques.
- DNA fragments also may be produced by restriction endonuclease digestion of a full length cloned DNA sequence, and isolated by electrophoresis on agarose gels.
- oligonucleotides that reconstruct the 5′ or 3′ terminus to a desired point may be ligated to a DNA fragment generated by restriction enzyme digestion.
- Such oligonucleotides may additionally contain a restriction endonuclease cleavage site upstream of the desired coding sequence, and position an initiation codon (ATG) at the N-terminus of the coding sequence.
- PCR polymerase chain reaction
- Oligonucleotides that define the desired termini of the DNA fragment are employed as 5′ and 3′ primers.
- the oligonucleotides may additionally contain recognition sites for restriction endonucleases, to facilitate insertion of the amplified DNA fragment into an expression vector.
- PCR techniques are described in (Saiki et al., Science, 239:487 (1988)); (Wu et al., Recombinant DNA Methodology, eds., Academic Press, Inc., San Diego, pp. 189-196 (1989)); and (Innis et al., PCR Protocols: A Guide to Methods and Applications, eds., Academic Press, Inc. (1990)).
- the invention encompasses polypeptides and fragments thereof in various forms, including those that are naturally occurring or produced through various techniques such as procedures involving recombinant DNA technology. Such forms include, but are not limited to derivatives, variants, and oligomers, as well as fusion proteins or fragments thereof.
- polypeptides of the invention include full length proteins encoded by the nucleic acid sequences set forth above. Particularly preferred polypeptides comprise the amino acid sequence of SEQ ID NO:3.
- polypeptides of the invention may be membrane bound or they may be secreted and thus soluble. Soluble polypeptides are capable of being secreted from the cells in which they are expressed. In general, soluble polypeptides may be identified (and distinguished from non-soluble membrane-bound counterparts) by separating intact cells which express the desired polypeptide from the culture medium, e.g., by centrifugation, and assaying the medium (supernatant) for the presence of the desired polypeptide. The presence of polypeptide in the medium indicates that the polypeptide was secreted from the cells and thus is a soluble form of the protein.
- the soluble polypeptides and fragments thereof comprise all or part of the extracellular domain, but lack the transmembrane region that would cause retention of the polypeptide on a cell membrane.
- a soluble polypeptide may include the cytoplasmic domain, or a portion thereof, as long as the polypeptide is secreted from the cell in which it is produced.
- soluble forms are advantageous for certain applications. Purification of the polypeptides from recombinant host cells is facilitated, since the soluble polypeptides are secreted from the cells. Further, soluble polypeptides are generally more suitable for intravenous administration.
- the invention also provides polypeptides and fragments of the extracellular domain that retain a desired biological activity.
- a fragment may be a soluble polypeptide, as described above.
- polypeptide fragments comprising at least 20, or at least 30, contiguous amino acids of the sequence of SEQ ID NO:3. Fragments derived from the cytoplasmic domain find use in studies of signal transduction, and in regulating cellular processes associated with transduction of biological signals. Polypeptide fragments also may be employed as immunogens, in generating antibodies.
- Variants may exhibit amino acid sequences that are at least 80% identical. Also contemplated are embodiments in which a polypeptide or fragment comprises an amino acid sequence that is at least 90% identical, at least 95% identical, at least 98% identical, at least 99% identical, or at least 99.9% identical to the preferred polypeptide or fragment thereof. Percent identity may be determined by visual inspection and mathematical calculation. Alternatively, the percent identity of two protein sequences can be determined by comparing sequence information using the GAP computer program, based on the algorithm of (Needleman and Wunsch, J. Mol. Bio., 48:443 (1970)) and available from the University of Wisconsin Genetics Computer Group (UWGCG).
- the preferred default parameters for the GAP program include: (1) a scoring matrix, blosum62, as described by (Henikoff and Henikoff Proc. Natl. Acad. Sci. USA, 89:10915 (1992)); (2) a gap weight of 12; (3) a gap length weight of 4; and (4) no penalty for end gaps.
- Other programs used by one skilled in the art of sequence comparison may also be used.
- the variants of the invention include, for example, those that result from alternate mRNA splicing events or from proteolytic cleavage.
- Alternate splicing of mRNA may, for example, yield a truncated but biologically active protein, such as a naturally occurring soluble form of the protein.
- Variations attributable to proteolysis include, for example, differences in the N- or C-termini upon expression in different types of host cells, due to proteolytic removal of one or more terminal amino acids from the protein (generally from 1-5 terminal amino acids). Proteins in which differences in amino acid sequence are attributable to genetic polymorphism (allelic variation among individuals producing the protein) are also contemplated herein.
- polypeptides that may be modified to create derivatives thereof by forming covalent or aggregative conjugates with other chemical moieties, such as glycosyl groups, lipids, phosphate, acetyl groups and the like.
- Covalent derivatives may be prepared by linking the chemical moieties to functional groups on amino acid side chains or at the N-terminus or C-terminus of a polypeptide.
- Conjugates comprising diagnostic (detectable) or therapeutic agents attached thereto are contemplated herein, as discussed in more detail below.
- Other derivatives include covalent or aggregative conjugates of the polypeptides with other proteins or polypeptides, such as by synthesis in recombinant culture as N-terminal or C-terminal fusions. Examples of fusion proteins are discussed below in connection with oligomers. Further, fusion proteins can comprise peptides added to facilitate purification and identification. Such peptides include, for example, poly-His or the antigenic identification peptides described in U.S. Pat. No. 5,011,912 and in (Hopp et al., Bio/Technology, 6:1204 (1988)).
- FLAG® peptide is the FLAG® peptide, Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, (SEQ ID NO:4) which is highly antigenic and provides an epitope reversibly bound by a specific monoclonal antibody, enabling rapid assay and facile purification of expressed recombinant protein.
- a murine hybridoma designated 4E 11 produces a monoclonal antibody that binds the FLAG® peptide in the presence of certain divalent metal cations, as described in U.S. Pat. No. 5,011,912, hereby incorporated by reference.
- the 4E11 hybridoma cell line has been deposited with the American Type Culture Collection under accession no. HB 9259. Monoclonal antibodies that bind the FLAG® peptide are available from Eastman Kodak Co., Scientific Imaging Systems Division, New Haven, Conn.
- variant polypeptides that retain the native biological activity or the substantial equivalent thereof.
- variants that binds with essentially the same binding affinity as does the native form. Binding affinity can be measured by conventional procedures, e.g., as described in U.S. Pat. No. 5,512,457 and as set forth below.
- Variants include polypeptides that are substantially homologous to the native form, but which have an amino acid sequence different from that of the native form because of one or more deletions, insertions or substitutions.
- Particular embodiments include, but are not limited to, polypeptides that comprise from one to ten deletions, insertions or substitutions of amino acid residues, when compared to a native sequence.
- a given amino acid may be replaced, for example, by a residue having similar physiochemical characteristics.
- conservative substitutions include substitution of one aliphatic residue for another, such as Ile, Val, Leu, or Ala for one another; substitutions of one polar residue for another, such as between Lys and Arg, Glu and Asp, or Gin and Asn; or substitutions of one aromatic residue for another, such as Phe, Trp, or Tyr for one another.
- Other conservative substitutions e.g., involving substitutions of entire regions having similar hydrophobicity characteristics, are well known.
- the DNAs of the invention include variants that differ from a native DNA sequence because of one or more deletions, insertions or substitutions, but that encode a biologically active polypeptide.
- the invention further includes polypeptides of the invention with or without associated native-pattern glycosylation.
- Polypeptides expressed in yeast or mammalian expression systems e.g., COS-1 or COS-7 cells
- yeast or mammalian expression systems e.g., COS-1 or COS-7 cells
- Expression of polypeptides of the invention in bacterial expression systems, such as E. Coli provides non-glycosylated molecules.
- a given preparation may include multiple differentially glycosylated species of the protein. Glycosyl groups can be removed through conventional methods, in particular those utilizing glycopeptidase.
- glycosylated polypeptides of the invention can be incubated with a molar excess of glycopeptidase (Boehringer Mannheim).
- N-glycosylation sites in the polypeptide extracellular domain can be modified to preclude glycosylation, allowing expression of a reduced carbohydrate analog in mammalian and yeast expression systems.
- N-glycosylation sites in eukaryotic polypeptides are characterized by an amino acid triplet Asn-X-Y, wherein X is any amino acid and Y is Ser or Thr.
- nucleotide sequence encoding these triplets will result in prevention of attachment of carbohydrate residues at the Asn side chain.
- the Ser or Thr can by replaced with another amino acid, such as Ala.
- Known procedures for inactivating N-glycosylation sites in proteins include those described in U.S. Pat. No. 5,071,972 and EP 276,846, hereby incorporated by reference.
- sequences encoding Cys residues that are not essential for biological activity can be altered to cause the Cys residues to be deleted or replaced with other amino acids, preventing formation of incorrect intramolecular disulfide bridges upon folding or renaturation.
- variants are prepared by modification of adjacent dibasic amino acid residues, to enhance expression in yeast systems in which KEX2 protease activity is present.
- EP 212,914 discloses the use of site-specific mutagenesis to inactivate KEX2 protease processing sites in a protein. KEX2 protease processing sites are inactivated by deleting, adding or substituting residues to alter Arg-Arg, Arg-Lys, and Lys-Arg pairs to eliminate the occurrence of these adjacent basic residues. Lys-Lys pairings are considerably less susceptible to KEX2 cleavage, and conversion of Arg-Lys or Lys-Arg to Lys-Lys represents a conservative and preferred approach to inactivating KEX2 sites.
- polypeptides and fragments of the invention may be accomplished by any suitable technique, including but not limited to the following:
- the present invention also provides recombinant cloning and expression vectors containing DNA, as well as host cell containing the recombinant vectors.
- Expression vectors comprising DNA may be used to prepare the polypeptides or fragments of the invention encoded by the DNA.
- a method for producing polypeptides comprises culturing host cells transformed with a recombinant expression vector encoding the polypeptide, under conditions that promote expression of the polypeptide, then recovering the expressed polypeptides from the culture.
- the skilled artisan will recognize that the procedure for purifying the expressed polypeptides will vary according to such factors as the type of host cells employed, and whether the polypeptide is membrane-bound or a soluble form that is secreted from the host cell.
- the vectors include a DNA encoding a polypeptide or fragment of the invention, operably linked to suitable transcriptional or translational regulatory nucleotide sequences, such as those derived from a mammalian, microbial, viral, or insect gene.
- suitable transcriptional or translational regulatory nucleotide sequences such as those derived from a mammalian, microbial, viral, or insect gene.
- regulatory sequences include transcriptional promoters, operators, or enhancers, an mRNA ribosomal binding site, and appropriate sequences which control transcription and translation initiation and termination.
- Nucleotide sequences are operably linked when the regulatory sequence functionally relates to the DNA sequence.
- a promoter nucleotide sequence is operably linked to a DNA sequence if the promoter nucleotide sequence controls the transcription of the DNA sequence.
- An origin of replication that confers the ability to replicate in the desired host cells, and a selection gene by which transformants are identified, are generally incorporated into the expression vector.
- a sequence encoding an appropriate signal peptide can be incorporated into expression vectors.
- a DNA sequence for a signal peptide may be fused in frame to the nucleic acid sequence of the invention so that the DNA is initially transcribed, and the mRNA translated, into a fusion protein comprising the signal peptide.
- a signal peptide that is functional in the intended host cells promotes extracellular secretion of the polypeptide. The signal peptide is cleaved from the polypeptide upon secretion of polypeptide from the cell.
- Suitable host cells for expression of polypeptides include prokaryotes, yeast or higher eukaryotic cells. Mammalian or insect cells are generally preferred for use as host cells. Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described, for example, in (Pouwels et al. Cloning Vectors: A Laboratory Manual, Elsevier, New York, (1985)). Cell-free translation systems could also be employed to produce polypeptides using RNAs derived from DNA constructs disclosed herein.
- Prokaryotes include gram-negative or gram-positive organisms. Suitable prokaryotic host cells for transformation include, for example, E. coli, Bacillus subtilis, Salmonella typhimurium , and various other species within the genera Pseudomonas, Streptomyces, and Staphylococcus.
- a polypeptide may include an N-terminal methionine residue to facilitate expression of the recombinant polypeptide in the prokaryotic host cell. The N-terminal Met may be cleaved from the expressed recombinant polypeptide.
- Expression vectors for use in prokaryotic host cells generally comprise one or more phenotypic selectable marker genes.
- a phenotypic selectable marker gene is, for example, a gene encoding a protein that confers antibiotic resistance or that supplies an autotrophic requirement.
- useful expression vectors for prokaryotic host cells include those derived from commercially available plasmids such as the cloning vector pBR322 (ATCC 37017).
- pBR322 contains genes for ampicillin and tetracycline resistance and thus provides simple means for identifying transformed cells.
- An appropriate promoter and a DNA sequence are inserted into the pBR322 vector.
- Other commercially available vectors include, for example, pKK223-3 (Pharmacia Fine Chemicals, Uppsala, Sweden) and pGEM1 (Promega Biotec, Madison, Wis., USA).
- Promoter sequences commonly used for recombinant prokaryotic host cell expression vectors include ⁇ -lactamase (penicillinase), lactose promoter system (Chang et al., Nature 275:615 (1978); and (Goeddel et al., Nature 281:544 (1979)), tryptophan (trp) promoter system (Goeddel et al., Nucl. Acids Res. 8:4057 (1980); and EP-A-36776) and tac promoter (Maniatis, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, p. 412 (1982)).
- a particularly useful prokaryotic host cell expression system employs a phage ⁇ P L promoter and a cI857ts thermolabile repressor sequence.
- Plasmid vectors available from the American Type Culture Collection which incorporate derivatives of the ⁇ P L promoter include plasmid pHUB2 (resident in E. coli strain JMB9, ATCC 37092) and pPLc28 (resident in E. coli RR1, ATCC 53082).
- the polypeptides may be expressed in yeast host cells, preferably from the Saccharomyces genus (e.g., S. cerevisiae ). Other genera of yeast, such as Pichia or Kluyveromyces, may also be employed.
- yeast vectors will often contain an origin of replication sequence from a 2 ⁇ yeast plasmid, an autonomously replicating sequence (ARS), a promoter region, sequences for polyadenylation, sequences for transcription termination, and a selectable marker gene.
- Suitable promoter sequences for yeast vectors include, among others, promoters for metallothionein, 3-phosphoglycerate kinase (Hitzeman et al., J. Biol. Chem.
- glycolytic enzymes Hess et al., J. Adv. Enzyme Reg. 7:149 (1968)); and (Holland et al., Biochem. 17:4900 (1978)), such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase.
- enolase glyceraldehyde-3-phosphate dehydrogenase
- hexokinase hexokinase
- pyruvate decarboxylase phosphofructokinase
- glucose-6-phosphate isomerase 3-phosphoglycerate mutase
- yeast vectors and promoters for use in yeast expression are further described in (Hitzeman, EPA-73,657).
- Another alternative is the glucose-repressible ADH2 promoter described by (Russell et al., J. Biol. Chem. 258:2674 (1982)) and (Beier et al., Nature 300:724 (1982)).
- Shuttle vectors replicable in both yeast and E. coli may be constructed by inserting DNA sequences from pBR322 for selection and replication in E. coli (Amp r gene and origin of replication) into the above-described yeast vectors.
- the yeast a-factor leader sequence may be employed to direct secretion of the polypeptide.
- the ⁇ -factor leader sequence is often inserted between the promoter sequence and the structural gene sequence. See, e.g., (Kurjan et al., Cell 30:933 (1982)) and (Bitter et al., Proc. Natl. Acad. Sci. USA 81:5330 (1984)).
- Other leader sequences suitable for facilitating secretion of recombinant polypeptides from yeast hosts are known to those of skill in the art.
- a leader sequence may be modified near its 3′ end to contain one or more restriction sites. This will facilitate fusion of the leader sequence to the structural gene.
- Yeast transformation protocols are known to those of skill in the art.
- One such protocol is described by (Hinnen et al., Proc. Natl. Acad. Sci. USA 75:1929 (1978)).
- the Hinnen et al. protocol selects for Trp + transformants in a selective medium, wherein the selective medium consists of 0.67% yeast nitrogen base, 0.5% casamino acids, 2% glucose, 10 mg/ml ademne and 20 mg/ml uracil.
- Yeast host cells transformed by vectors containing an ADH2 promoter sequence may be grown for inducing expression in a “rich” medium.
- a rich medium is one consisting of 1% yeast extract, 2% peptone, and 1% glucose supplemented with 80 mg/ml adenine and 80 mg/ml uracil. Derepression of the ADH2 promoter occurs when glucose is exhausted from the medium.
- Mammalian or insect host cell culture systems also may be employed to express recombinant polypeptides.
- Bacculovirus systems for production of heterologous proteins in insect cells are reviewed by (Luckow and Summers, Bio/Technology, 6:47 (1988)).
- Established cell lines of mammalian origin also may be employed.
- suitable mammalian host cell lines include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (Gluzman et al., Cell 23:175 (1981)), L cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells, HeLa cells, and BHK (ATCC CRL 10) cell lines, and the CV1/EBNA cell line derived from the African green monkey kidney cell line CV1 (ATCC CCL 70) as described by (McMahan et al., EMBO J., 10: 2821 (1991)).
- DHFR dihydrofolate reductase resistance.
- a suitable host strain for DHFR selection can be CHO strain DX-B 11, which is deficient in DHFR (Urlaub and Chasin, Proc. Natl. Acad. Sci. USA 77:4216-4220 (1980)).
- a plasmid expressing the DHFR cDNA can be introduced into strain DX-B11, and only cells that contain the plasmid can grow in the appropriate selective media.
- selectable markers include cDNAs conferring resistance to antibiotics, such as G418 and hygromycin B. Cells harboring the vector can be selected on the basis of resistance to these compounds.
- Transcriptional and translational control sequences for mammalian host cell expression vectors can be excised from viral genomes.
- Commonly used promoter sequences and enhancer sequences are derived from polyoma virus, adenovirus 2, simian virus 40 (SV40), and human cytomegalovirus.
- DNA sequences derived from the SV40 viral genome for example, SV40 origin, early and late promoter, enhancer, splice, and polyadenylation sites can be used to provide other genetic elements for expression of a structural gene sequence in a mammalian host cell.
- Viral early and late promoters are particularly useful because both are easily obtained from a viral genome as a fragment, which can also contain a viral origin of replication (Fiers et al.
- SV40 fragments can also be used, provided the approximately 250 bp sequence extending from the Hind III site toward the Bgl I site located in the SV40 viral origin of replication site is included.
- Additional control sequences shown to improve expression of heterologous genes from mammalian expression vectors include such elements as the expression augmenting sequence element (EASE) derived from CHO cells (Morris et al., Animal Cell Technology, pp. 529-53.4 and PCT Application WO 97/25420 (1997)) and the tripartite leader (TPL) and VA gene RNAs from Adenovirus 2 (Gingeras et al., J. Biol. Chem. 257:13475-13491 (1982)).
- EASE expression augmenting sequence element
- TPL tripartite leader
- VA gene RNAs from Adenovirus 2
- the internal ribosome entry site (IRES) sequences of viral origin allows dicistronic mRNAs to be translated efficiently (Oh and Sarnow, Current Opinion in Genetics and Development 3:295-300 (1993)); (Ramesh et al., Nucleic Acids Research 24:2697-2700 (1996)).
- IRS internal ribosome entry site
- a heterologous cDNA as part of a dicistronic mRNA followed by the gene for a selectable marker (e.g. DHFR) has been shown to improve transfectability of the host and expression of the heterologous cDNA (Kaufman, Meth. in Enzymology (1990)).
- Exemplary expression vectors that employ dicistronic mRNAs are pTR-DC/GFP described by (Mosser et al., Biotechniques 22:150-161 (1997)), and p2A5I described by (Morris et al., Animal Cell Technology, pp. 529-534 (1997)).
- a useful high expression vector, pCAVNOT has been described by (Mosley et al., Cell 59:335-348 (1989)).
- Other expression vectors for use in mammalian host cells can be constructed as disclosed by (Okayama and Berg, Mol. Cell. Biol. 3:280 (1983)).
- a useful system for stable high level expression of mammalian cDNAs in C127 murine mammary epithelial cells can be constructed substantially as described by (Cosman et al., Mol. Immunol. 23:935 (1986)).
- a useful high expression vector, PMLSV N1/N4 described by (Cosman et al., Nature 312:768 (1984)), has been deposited as ATCC 39890. Additional useful mammalian expression vectors are described in EP-A-0367566, and in WO 91/18982, incorporated by reference herein.
- the vectors can be derived from retroviruses.
- pFLAG® Another useful expression vector, pFLAG®, can be used.
- FLAG® technology is centered on the fusion of a low molecular weight (1 kD), hydrophilic, FLAG® marker peptide to the N-terminus of a recombinant protein expressed by pFLAG® expression vectors.
- pDC311 is another specialized vector used for expressing proteins in CHO cells. pDC311 is characterized by a bicistronic sequence containing the gene of interest and a dihydrofolate reductase (DHFR) gene with an internal ribosome binding site for DHFR translation, an expression augmenting sequence element (EASE), the human CMV promoter, a tripartite leader sequence, and a polyadenylation site.
- DHFR dihydrofolate reductase
- the invention also includes methods of isolating and purifying the polypeptides and fragments thereof.
- the “isolated” polypeptides or fragments thereof encompassed by this invention are polypeptides or fragments that are not in an environment identical to an environment in which it or they can be found in nature.
- the “purified” polypeptides or fragments thereof encompassed by this invention are essentially free of association with other proteins or polypeptides, for example, as a purification product of recombinant expression systems such as those described above or as a purified product from a non-recombinant source such as naturally occurring cells and/or tissues.
- the purification of recombinant polypeptides or fragments can be accomplished using fusions of polypeptides or fragments of the invention to another ii polypeptide to aid in the purification of polypeptides or fragments of the invention.
- the recombinant polypeptide or fragment can be isolated from the host cells if not secreted, or from the medium or supernatant if soluble and secreted, followed by one or more concentration, salting-out, ion exchange, hydrophobic interaction, affinity purification or size exclusion chromatography steps.
- the culture medium first can be concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit.
- the concentrate can be applied to a purification matrix such as a gel filtration medium.
- an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups.
- the matrices can be acrylamide, agarose, dextran, cellulose or other types commonly employed in protein purification.
- a cation exchange step can be employed.
- Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups.
- a chromatofocusing step can be employed.
- a hydrophobic interaction chromatography step can be employed.
- Suitable matrices can be phenyl or octyl moieties bound to resins.
- affinity chromatography with a matrix which selectively binds the recombinant protein can be employed. Examples of such resins employed are lectin columns, dye columns, and metal-chelating columns.
- RP-HPLC reversed-phase high performance liquid chromatography
- hydrophobic RP-HPLC media e.g., silica gel or polymer resin having pendant methyl, octyl, octyldecyl or other aliphatic groups
- RP-HPLC media e.g., silica gel or polymer resin having pendant methyl, octyl, octyldecyl or other aliphatic groups
- an affinity column comprising a polypeptide-binding protein of the invention, such as a monoclonal antibody generated against polypeptides of the invention, to affinity-purify expressed polypeptides.
- polypeptides can be removed from an affinity column using conventional techniques, e.g., in a high salt elution buffer and then dialyzed into a lower salt buffer for use or by changing pH or other components depending on the affinity matrix utilized, or be competitively removed using the naturally occurring substrate of the affinity moiety, such as a polypeptide derived from the invention.
- polypeptide-binding proteins such as the anti-polypeptide antibodies of the invention or other proteins that may interact with the polypeptide of the invention, can be bound to a solid phase support such as a column chromatography matrix or a similar substrate suitable for identifying, separating, or purifying cells that express polypeptides of the invention on their surface.
- Adherence of polypeptide-binding proteins of the invention to a solid phase contacting surface can be accomplished by any means, for example, magnetic microspheres can be coated with these polypeptide-binding proteins and held in the incubation vessel through a magnetic field. Suspensions of cell mixtures are contacted with the solid phase that has such polypeptide-binding proteins thereon.
- Cells having polypeptides of the invention on their surface bind to the fixed polypeptide-binding protein and unbound cells then are washed away.
- This affinity-binding method is useful for purifying, screening, or separating such polypeptide-expressing cells from solution.
- Methods of releasing positively selected cells from the solid phase are known in the art and encompass, for example, the use of enzymes. Such enzymes are preferably non-toxic and non-injurious to the cells and are preferably directed to cleaving the cell-surface binding partner.
- mixtures of cells suspected of containing polypeptide-expressing cells of the invention first can be incubated with a biotinylated polypeptide-binding protein of the invention. Incubation periods are typically at least one hour in duration to ensure sufficient binding to polypeptides of the invention.
- the resulting mixture then is passed through a column packed with avidin-coated beads, whereby the high affinity of biotin for avidin provides the binding of the polypeptide-binding cells to the beads.
- avidin-coated beads is known in the art. See (Berenson, et al. J. Cell. Biochem., 10D:239 (1986)). Wash of unbound material and the release of the bound cells is performed using conventional methods.
- the desired degree of purity depends on the intended use of the protein.
- a relatively high degree of purity is desired when the polypeptide is to be administered in vivo, for example.
- the polypeptides are purified such that no protein bands corresponding to other proteins are detectable upon analysis by SDS-polyacrylamide gel electrophoresis (SDS-PAGE). It will be recognized by one skilled in the pertinent field that multiple bands corresponding to the polypeptide may be visualized by SDS-PAGE, due to differential glycosylation, differential post-translational processing, and the like.
- the polypeptide of the invention is purified to substantial homogeneity, as indicated by a single protein band upon analysis by SDS-PAGE.
- the protein band may be visualized by silver staining, Coomassie blue staining, or (if the protein is radiolabeled) by autoradiography.
- Antibodies that are immunoreactive with the polypeptides of the invention are provided herein. Such antibodies specifically bind to the polypeptides via the antigen-binding sites of the antibody (as opposed to non-specific binding).
- the polypeptides, fragments, variants, fusion proteins, etc., as set forth above may be employed as “immunogens” in producing antibodies immunoreactive therewith. More specifically, the polypeptides, fragment, variants, fusion proteins, etc. contain antigenic determinants or epitopes that elicit the formation of antibodies.
- These antigenic determinants or epitopes can be either linear or conformational (discontinuous).
- Linear epitopes are composed of a single section of amino acids of the polypeptide, while conformational or discontinuous epitopes are composed of amino acids sections from different regions of the polypeptide chain that are brought into close proximity upon protein folding (C. A. Janeway, Jr. and P. Travers, Immuno Biology 3:9, Garland Publishing Inc., 2nd ed. (1996)).
- the number of epitopes available is quite numerous; however, due to the conformation of the protein and steric hinderances, the number of antibodies that actually bind to the epitopes is less than the number of available epitopes (C. A. Janeway, Jr. and P. Travers, Immuno Biology 2:14, Garland Publishing Inc., 2nd ed. (1996)).
- Epitopes may be identified by any of the methods known in the art.
- one aspect of the present invention relates to the antigenic epitopes of the polypeptides of the invention.
- Such epitopes are useful for raising antibodies, in particular monoclonal antibodies, as described in more detail below.
- epitopes from the polypeptides of the invention can be used as research reagents, in assays, and to purify specific binding antibodies from substances such as polyclonal sera or supernatants from cultured hybridomas.
- Such epitopes or variants thereof can be produced using techniques well known in the art such as solid-phase synthesis, chemical or enzymatic cleavage of a polypeptide, or using recombinant DNA technology.
- both polyclonal and monoclonal antibodies may be prepared by conventional techniques. See, for example, (Kennet et al., Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, eds., Plenum Press, New York (1980); and Harlow and Land, Antibodies: A Laboratory Manual, eds., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., (1988)).
- Hybridoma cell lines that produce monoclonal antibodies specific for the polypeptides of the invention are also contemplated herein. Such hybridomas may be produced and identified by conventional techniques.
- One method for producing such a hybridoma cell line comprises immunizing an animal with a polypeptide; harvesting spleen cells from the immunized animal; fusing said spleen cells to a myeloma cell line, thereby generating hybridoma cells; and identifying a hybridoma cell line that produces a monoclonal antibody that binds the polypeptide.
- the monoclonal antibodies may be recovered by conventional techniques.
- the monoclonal antibodies of the present invention include chimeric antibodies, e.g., humanized versions of murine monoclonal antibodies. Such humanized antibodies may be prepared by known techniques and offer the advantage of reduced immunogenicity when the antibodies are administered to humans.
- a humanized monoclonal antibody comprises the variable region of a murine antibody (or just the antigen binding site thereof) and a constant region derived from a human antibody.
- a humanized antibody fragment may comprise the antigen binding site of a murine monoclonal antibody and a variable region fragment (lacking the antigen-binding site) derived from a human antibody.
- Procedures for the production of chimeric and further engineered monoclonal antibodies include those described in (Riechmann et al., Nature 332:323 (1988), Liu et al., PNAS 84:3439 (1987), Larrick et al., Bio/Technology 7:934 (1989), and Winter and Harris, TIPS 14:139 (May 1993)).
- Procedures to generate antibodies transgenically can be found in GB 2,272,440, U.S. Pat. Nos. 5,569,825 and 5,545,806 and related patents claiming priority therefrom, all of which are incorporated by reference herein.
- Antigen-binding fragments of the antibodies which may be produced by conventional techniques, are also encompassed by the present invention.
- fragments include, but are not limited to, Fab and F(ab′) 2 fragments.
- Antibody fragments and derivatives produced by genetic engineering techniques are also provided.
- the antibodies are specific for the polypeptides of the present invention and do not cross-react with other proteins. Screening procedures by which such antibodies may, be identified are well known, and may involve immunoaffinity chromatography, for example.
- LNCaP cells (American Type Culture Collection, Rockville, Md.) were used for SAGE analysis of ARGs. LNCaP cells were maintained in RPMI 1640 (Life Technologies, Inc., Gaithersburg, Md.) supplemented with 10% fetal bovine serum (FBS, Life Technologies, Inc., Gaithersburg, Md.) and experiments were performed on cells between passages 20 and 30. For the studies of androgen regulation, charcoal/dextran stripped androgen-free FBS (cFBS, Gemini Bio-Products, Inc., Calabasas, Calif.) was used.
- FBS fetal bovine serum
- LNCaP cells were cultured first in RPMI 1640 with 10% cFBS for 5 days and then stimulated with 10-8 M of non-metabolizable androgen analog, R1881 (DUPONT, Boston, Mass.) for 24 hours.
- LNCAP cells identically treated but without R1881 treatment served as control.
- Cells were harvested at indicated time and polyA ⁇ RNA was double-selected with Fast Track kit (Invitrogene). The quality of polyA+ was checked by Northern hybridization analysis.
- Ditags were concatamerized, purified and cloned in plasmid pZero cloning vector (Invitrogen, CA). The clones containing concatamers were screened by PCR and sequenced. The sequence and the occurrence of each of the SAGE tags was determined using the SAGE software kindly provided by Dr. Kenneth W. Kinzler (Johns Hopkins University School of Medicine, Baltimore, Md.).
- SAGE tags sequences were analyzed for identity to DNA sequence in GenBank (National Center for Biotechnology Information, Bethesda, Md., USA). The relative abundance of each transcript was determined by dividing the number of individual tags by total tags in the library. The copy number of each gene was calculated assuming there are approximately 300,000 transcripts in a cell (Zhang et al., 1997).
- the differentially expressed SAGE tags were determined by comparing the frequency of occurrence of individual tags in the two libraries obtained from the control (library LNCaP-C) and R1881 treated LNCaP cells (library LNCaP-T). The results were analyzed with t test, and p ⁇ 0.05 was considered as a statistically significant difference for a specific tag between these two libraries.
- LNCaP cells were cultured in RPMI 1640 with 10% cFBS for 5 days, then stimulated with R1881 at 10-10, 10-8, and 10-6 M for 1, 3, 12, 24, 72, 120, 168, and 216 hours. LNCaP cells identically treated but without R1881 served as control. The cells were harvested at indicated time and polyA+ RNA was prepared as described as above. The polyA+ RNA was fractionated (2 ⁇ g/lane) by running through 1% formmaldehyde-agarose gel and transferred to nylon membrane. The cDNA probes of several ARGs were labeled with 32 P-dCTP by random priming (Stratagene Cloning Systems, La Jolla, Calif.).
- nylon membranes were prehybridized for 2 hrs in hybridization buffer (10 mM Tris-HCl, pH 7.5, 10% Dextran sulfate, 40% Formamide, 5 ⁇ SSC, 5 ⁇ Denhardt's solution and 0.25 mg/ml salmon sperm DNA) and hybridized to the 32 P labeled probes (1 ⁇ 106 cpm/ml) in the same buffer at 40° C. for 12-16 hrs. Blots were washed twice in 2 ⁇ SSC/0.1% SDS for 20 min at room temperature followed by two high-stringency wash with 0.1 ⁇ SSC/0.1% SDS at 50° C. for 20 min. Nylon membranes were exposed to X-ray film for autoradiography.
- CWR22 (androgen dependent) and CWR22R (androgen relapsed) tumor specimens were kindly provided by Dr. Thomas Pretlow (Case Western Reserve University School of Medicine).
- the tissue samples were homogenized and polyA+ RNA was extracted with Fast Track kit (Invitrogen) following manufacture's protocol.
- Northern blots were prepared as described in Example 3 and were hybridized with 32 P labeled probes of the cDNA of interest.
- the remaining 83,489 tags represented a total of 23,448 known genes or ESTs and 1,655 tags did not show any match in the GeneBank data base.
- the relative abundance of the SAGE tags varied between 0.0011% and 1.7%. Assuming that there are 18,000 transcripts per cell type and there are about 83,489 anticipated total transcripts, the estimated abundance of transcripts will be 0.2-308 copies per cell. This calculation indicated that single copy genes had high chance to be recognized by SAGE analysis in this study. The distribution of transcripts by copy number suggests that the majority (above 90%) of the genes in our analysis are expressed at 1 or 2 copies level/cell. A total of 46,186 and 45,309 tags were analyzed in the control (C) and R1881 (T) groups respectively.
- Unique SAGE tags corresponding to known genes, expressed sequence tags (ESTs) and novel transcripts were 15,593 and 15,920 in the control and androgen treated groups respectively. About 94% of the unique SAGE tags in each group showed a match to a sequence in the gene bank and 6% SAGE tags represented novel transcripts.
- the most abundant SAGE tags in both control and androgen treated LNCaP cells represented proteins involved in cellular translation machinery e.g., ribosomal proteins, translation regulators, mitochondrial proteins involved in bio-energetic pathways.
- SAGE tags between control and R1881 also revealed that 74 SAGE tags were significantly up-regulated (p ⁇ 0.05) by four-fold and 120 SAGE tags were significantly (p ⁇ 0.05) down-regulated.
- Two SAGE tags corresponding to the PSA gene sequence exhibited highest induction (16 fold) between androgen treated (T) and control (C) groups.
- Another prostate specific androgen regulated gene, NKX3.1 was among significantly up-regulated ARGs (8 fold).
- Prostate specific membrane antigen (PSMA) and Clusterin known to be down-regulated by androgens were among the SAGE tags exhibiting decreased expression in response to androgen (PSMA, 4 fold; Clusterin, fold).
- LNCaP C/T-SAGE tag libraries were compared to a bank of 35 SAGE tag libraries (http://www.ncbi.nlm.nih.gov/SAGE/) containing 1.5 million tags from diverse tissues and cell types.
- Our analysis revealed that known prostate specific genes e.g., PSA and NKX3.1 were found only in LNCaP SAGE tag libraries (this report and one LNCaP SAGE library present in the SAGE tag bank).
- PSA and NKX3.1 were found only in LNCaP SAGE tag libraries (this report and one LNCaP SAGE library present in the SAGE tag bank).
- On the basis of abundant/unique expression of the SAGE tag defined transcripts in LNCaP SAGE tag libraries relative to other libraries we have now identified several candidate genes and ESTs whose expression are potentially prostate specific or restricted (Table 4).
- the utility of such prostate-specific genes includes: (a) the diagnosis and prognosis of CaP (
- the mitochondrial transcription factor 1 (mtTF1) was induced by 8 fold in response to R1881.
- mtTF1 mitochondrial transcription factor 1
- PGC-1 nuclear receptor superfamily
- ear-2 a thyroid hormone receptor related gene, ear-2 (Miyajima et al., 1998) was also upregulated by R188. It is striking to note that expression of four [NKX3.1 (He et al., 1997).
- HOX B13 (Sreenath et al., 1999), mtTF1 and PDEF (Oettgen et al., 2000)] of the eight transcription regulators listed in Table 9 appear to be prostate tissue abundant/specific based on published reports as well as our analysis described above.
- ARGs also include a number of proteins involved in cellular energy metabolism and it is possible that some of these enzymes may be transcriptionally regulated by mtTF1.
- VDAC-2 (Blachly-Dyson et al., 1994), a member of small pore forming proteins of the outer mitochondrial membrane and which may regulate the transport of small metabolites necessary for oxidative-phosphorylation, was also up regulated by androgen.
- Diazepam binding protein (DBI) a previous reported ARG (Swinnen et al., 1996), known to be associated with the VDAC complex and implicated in a multitude of functions including modulation of pheripheral benzodiaepine receptor, acyl-CoA metabolism and mitochondrial steroidogenesis (Knudsen et al., 1993) were also induced by androgen in our study.
- a thioredoxin like protein (Miranda-Vizuete et al., 1998) which may function in modulating the cellular redox state was down regulated by androgen. In general, it appears that modulation of ARGs involved in regulating cellular redox status and energy metabolism may effect reactive oxygen species concentrations.
- a number of cell proliferation associated proteins regulating cell cycle, signal transduction and cellular protein trafficking were upregulated by androgen, further supporting the role of androgens in survival and growth of prostatic epithelial cells. Androgen regulation of two proteins: XRCC2 (Cartxvrght et al., 1998) and RPA3 (Umbricht et al., 1993) involved in DNA repair and recombination is a novel and interesting finding. Induction of these genes may represent a response to DNA damage due to androgen mediated pro-oxidant shift, or these genes simply represent components of genomic surveillance mechanisms stimulated by cell proliferation.
- RNA processing and translation components Gene expression modulations in RNA processing and translation components is consistent with increased protein synthesis expected in cells that are switched to a highly proliferative state.
- nucleolin one of the highly androgen induced genes (12 fold) which is an abundant nucleolar protein associating with cell proliferation and plays a direct role in the biogenesis, processing and transport of ribosomes to the cytoplasm (Srivastava and Pollard, 1999).
- Another androgen up-regulated gene, exportin, a component of the nuclear pore may be involved in the shuttling of nucleolin.
- SAGE technology has enabled us to develop the first quantitative database of androgen regulated transcripts. Comparison of our SAGE tag libraries to the SAGE TagBank has also revealed a number of new candidate genes and ESTs whose expression is potentially abundant or specific to the prostate. We have also identified a large number of transcripts not previously defined as ARGs.
- cDNA library screening and Sequencing of cDNA clone One of the SAGE tags (14 bp) showing the highest induction by androgen (29-fold) exhibited homology to an EST in the GenBank EST database.
- PCR primers (5′GGCAGAACACTCCGCGCTTCTTAG3′ (SEQ ID NO. 5) and 5′CAAGCTCTCTTAGCTTGTGCATTC3′ (SEQ ID NO. 6)) were designed based on the EST sequence (accession number AA310984).
- RT-PCR was performed using RNA from R1881 treated LNCaP cells and the co-identity of the PCR product to the EST was confirmed by DNA sequencing.
- the normal prostate cDNA library was screened through the service provided by Genome Systems (St. Louis, Mo.).
- An isolated clone, GS 22381 was sequenced using the 310 Genetic Analyzer (PE Applied Biosystems, Foster Calif.) and 750 bp of DNA sequence was defined, which included 2/3 of the coding region of PMEPA1.
- a GenBank search with PMEPA1 cDNA sequence revealed one EST clone (accession number AA088767) homologous to the 5′ region of the PMEPA1 sequence.
- PCR primers were designed using the EST clone (5′ primer) and PMEPA1 (3′ primer) sequence.
- cDNA from LNCaP cells was PCR amplified and the PCR product was sequenced using the PCR primers. The sequences were verified using at least two different primers. A contiguous sequence of 1,141 bp was generated by these methods.
- LNCaP cells (American Type Culture Collection, ATCC, Rockville Md.) were maintained in RPMI 1640 media (Life Technologies, Inc., Gaithersburg, Md.) supplemented with 10% fetal bovine serum (FBS, Life Technologies, Inc., Gaithersburg, Md.) and experiments were performed on cells cultured between passages 20 and 30.
- FBS fetal bovine serum
- charcoal/dextran stripped androgen-free FBS cFBS, Gemini Bio-Products, Inc., Calabasas, Calif.
- LNCaP cells were cultured first in RPMI 1640 with 10% cFBS for 5 days, and then stimulated with R1881 (DUPONT, Boston, Mass.) at 10-10 M and 108 M for 3, 6, 12 and 24 hours. LNCaP cells identically treated but without R1881 served as control. To study the effects of androgen withdrawal on PMEPA1 gene expression, LNCaP cells were cultured in RPMI 1640 with 10% cFBS for 24, 72 and 96 hours. Poly A + RNA samples derived from cells treated with or without R18881 were extracted at indicated time points with a Fast Track mRNA extraction kit (Invitrogen, Carlsbad, Calif.) following the manufacturer's protocol.
- R1881 DUPONT, Boston, Mass.
- RNA specimens (2 ⁇ g/lane) were electrophoresed in a 1% formaldehyde-agarose gel and transferred to a nylon membrane.
- Two PMEPA1 probes used for Northern blots analysis were (a) cDNA probe spanning nucleotides 3-437 of PMEPA1 cDNA sequence (See Table 1) and (b) 71-mer oligonucleotide between nucleotides 971 to 1,041 of PMEPA1 cDNA sequence (See Table 1).
- the cDNA probe was generated by RT-PCR with primers 5′CTTGGGTTCGGGTGAAAGCGCC 3′ (SEQ ID NO. 7) (sense) and 5′GGTGGGTGGCAGGTCGATCTCG 3′ (SEQ ID NO. 8) (antisense).
- PMEPA1 oligonucleotide and cDNA probes and glyceraldehyde phosphate dehydrogenase gene (GAPDH) cDNA probe were labeled with 32 P-dCTP using 3′ end tailing for oligonucleotides (Promega, Madison, Wis.) and random priming for cDNA (Stratagene, La Jolla, Calif.).
- nylon membranes were treated with hybridization buffer (10 mM Tris-HCl, pH 7.5, 10% Dextran sulfate, 40% Formamide, 5 ⁇ SSC, 5 ⁇ Denhardt's solution and 0.25 mg/ml salmon sperm DNA) for two hours followed by hybridization in the same buffer containing the 32 P labeled probes (1 ⁇ 10 6 cpm/ml) for 12-16 hrs at 40° C. Blots were washed twice in 2 ⁇ SSC/0.1% SDS for 20 min at room temperature followed by two high-stringency washes with 0.1 ⁇ SSC/0.1% SDS at 58° C. for 20 min. Nylon membranes were exposed to X-ray film for autoradiography. The bands on films were then quantified with N1H-Image processing software.
- CWR22 is an androgen-dependent, serially transplantable nude mouse xenograft derived from a primary human prostate cancer.
- Transplanted CWR22 tumors are positive for AR and the growth of CWR22 is androgen dependent.
- CWR22 tumors regress initially upon castration followed by a relapse.
- the recurrent CWR22 tumors (CWR22R) express AR, but the growth of these tumors become androgen-independent (Gregory et al., 1998; Nagabhushan et al., 1996).
- One CW 2 and four CWR22R tumor specimens were kindly provided by Dr. Thomas Pretlow's laboratory (Case Western Reserve University School of Medicine). Tumor tissues were homogenized and poly A + RNA were extracted as above. Poly A + RNA blots were made and hybridized as described above.
- PMEPA1 expression analysis in multiple human tissues and cell lines Multiple Tissue Northern blots containing mRNA samples from 23 human tissues and Master Dot blots containing mRNA samples from 50 different human tissues were purchased from ClonTech (Palo Alto, Calif.). The blots were hybridized with PMEPA1 cDNA and oligo probes, as described above. The expression of PMEPA1 in normal prostate epithelial cells (Clonetics, San Diego, Calif.), prostate cancer cells PC3 (ATCC) and LNCaP cells and breast cancer cells MCF7 (ATCC) was also analyzed by northern blot.
- Digoxigenin labeled antisense and sense riboprobes were synthesized using an in vitro RNA transcription kit (Boehringer Mannheim, GMbH, Germany) and a linearized plasmid with PMEPA1 gene fragment as templates. Frozen normal and malignant prostate tissues were fixed in 4% paraformaldehyde for 30 min. Prehybridization and hybridization were performed at 55° C. After hybridization, slides were sequentially washed with 2 ⁇ SSC at room temperature for 30 min, 2 ⁇ SSC at 58° C. for 1 hr and 0.1 ⁇ SSC at 58° C. for 1 hr. Antibody against digoxygenin was used to detect the signal and NBT/BCIP was used as substrate for color development (Boehringer Mannheim, GMbH, Germany). The slides were evaluated under an Olympus BX-60 microscope.
- Table 1 represents the nucleotide and predicted amino acid sequence of PMEPA1 (GenBank accession No. AF224278). The potential initiation methionine codon and the translation stop codons are indicated in bold. The transmembrane domain is underlined. The locations of the intron/exon boundaries are shown with arrows, which were determined by comparison of the PMEPA1 cDNA sequence to the publicly available sequences of human clones RP5-1059L7 and 718J7 (GenBank accession No. AL121913 and AL035541).
- a GenBank search revealed a sequence match of PMEPA1 cDNA to two genomic clones, RP5-1059L7 (accession number AL121913 in the GenBank/htgc database) and 718J7 (accession number AL035541 in the GenBank/nr database). These two clones mapped to Chromosome 20q13.2-13.33 and Chromosome 20q13.31-13.33. This information provided evidence that PMEPA1 is located on chromosome 20q13.
- PMEPA1 also shares other features with C18orf1, e.g., similar size of the predicted protein and similar transmembrane domain as the ⁇ 1 isoform of C18orf1.
- C18orf1 SEQ ID NO: 11
- C18orf1 SEQ ID NO: 12
- PMEPA1 S G E + PR DR P F QR+RF RFQPTYPY
- PMEPA1 was originally identified as a SAGE tag showing the highest fold induction (29-fold) by androgen. Androgen depletion of LNCaP cells resulted in decreased expression of PMEPA1. Androgen supplementation of the LNCaP cell culture media lacking androgen caused induction of both ⁇ 2.7 and ⁇ 5.0 bp RNA species of PMEPA1 in LNCaP cells in a dose and time dependent fashion (FIG. 2A). Basal level of PMEPA1 expression was detected in normal prostatic epithelial cell cultures and androgen-dependent LNCaP cells cultured in regular medium. PMEPA1 expression was not detected in AR negative CaP cells. PC3 or in the breast cancer cell line, MCF7 (FIG. 2B).
- AA280663 EST Up-regulated by Androgen U31657 KRAB-associated protein 1 Up-regulated by Androgen AI879709 EST Up-regulated by Androgen AA602190 EST Up-regulated by Androgen AF035587 Homo sapiens X-ray repair cross-complementing Up-regulated by Androgen protein 2 (XRCC2) AF151898 Homo sapiens CGI-140 protein mRNA Up-regulated by Androgen AA418786 No reliable matches, only see in two linberary (1 Up-regulated by Androgen each) AI308812 EST Up-regulated by Androgen X59408 Membrane cofactor protein (CD46, trophoblast- Up-regulated by Androgen lymphocyte cross-reactive antigen) X81817 Accessory proteins BAP31/BAP29 Up-regulated by Androgen AF071538 Homo sapiens Ets transcription factor PDEF Up-regulated by Androgen (PDEF) mRNA, complete NM_00
- Androgen U58855 Guanylate cyclase 1, soluble, alpha 3 Up-regulated by Androgen X12794 Human v-erbA related ear-2 gene.
- Androgen U88542 Mus musculus homeobox protein Nkx3.1 Up-regulated by Androgen D89729 Homo sapiens mRNA for CRM1 protein, complete Up-regulated by Androgen cds.
- Up-regulated by Androgen AI310341 EST Up-regulated by Androgen U49436 Human translation initiation factor 5 (eIF5) mRNA, Up-regulated by Androgen complete cds S79862 Proteasome (prosome, macropain) 26S subunit, non- Up-regulated by Androgen ATPase, 5 M14200 Human diazepam binding inhibitor (DBI) mRNA, Up-regulated by Androgen complete cds.
- Up-regulated by Androgen AF000979 Homo sapiens testis-specific Basic Protein Y 1 Up-regulated by Androgen (BPY1) mRNA, AA889510 EST Up-regulated by Androgen AB018330 Homo sapiens mRNA for KIAA0787 protein, partial Up-regulated by Androgen cds.
- AA026941 EST Up-regulated by Androgen AA532377
- Chromosome 1 open reading frame 8 Up-regulated by Androgen AF010313
- Homo sapiens Pig8 (PIG8) mRNA etoposide- Up-regulated by Androgen induced mRNA
- L06328 Human voltage-dependent anion channel isoform 2 Up-regulated by Androgen (VDAC) mRNA
- U41804 Human putative T1/ST2 receptor binding protein Up-regulated by Androgen precursor mRNA
- AB020676 Homo sapiens mRNA for KIAA0869 protein, partial Up-regulated by Androgen cds.
- AA120930 EST Up-regulated by Androgen AB002321 Human mRNA for KIAA0323 gene, partial cds Up-regulated by Androgen AF151837 Homo sapiens CGI-79 protein mRNA, complete cds Up-regulated by Androgen AA481027 EST Up-regulated by Androgen AA039343 EST Up-regulated by Androgen U09716 Human mannose-specific lectin (MR60) mRNA, Up-regulated by Androgen complete cds.
- MR60 Human mannose-specific lectin
- AF044773 Homo sapiens breakpoint cluster region protein 1 Up-regulated by Androgen BCRG1 mRNA U51586 Human siah binding protein 1 (SiahBP1) mRNA, Up-regulated by Androgen partial cds.
- AI282096 EST Up-regulated by Androgen W45510 RAB7, member RAS oncogene family-like 1 Up-regulated by Androgen X16135
- X61123 B-cell translocation gene 1 anti-proliferative Up-regulated by Androgen X63423 H.sapiens mRNA for delta-subunit of mitochondrial Up-regulated by Androgen F1F0 ATP-synthase AJ010025 Homo sapiens mRNA for unr-interacting protein. Down-regulated by Androgen AF003938 Homo sapiens thioredoxin-like protein mRNA, Down-regulated by Androgen complete cds.
- CTBP1 C-terminal binding protein 1
- BTF1 Human butyrophilin
- SIII Transcription elongation factor B (SIII), polypeptide Down-regulated by Androgen 1-like M34539 FK506-binding protein 1A (12kD) Down-regulated by Androgen N43807 yy19a05.r1 Soares melanocyte 2NbHM Homo Down-regulated by Androgen sapiens cDNA clone U03269 Human actin capping protein alpha subunit (CapZ) Down-regulated by Androgen mRNA, complete AI571685 EST Down-regulated by Androgen AA010412 EST Down-regulated by Androgen L40403 Homo sapiens (clone zap3) mRNA, 3′ end of cds.
- CapZ Human actin capping protein alpha subunit
- RNA-binding protein 1 Down-regulated by Androgen NM_006560 CUG triplet repeat RNA-binding protein 1 Down-regulated by Androgen NM_004713
- Serologically defined colon cancer antigen 1 Down-regulated by Androgen U36188 Clathrin-associated/assembly/adaptor protein Down-regulated by Androgen medium 1 AB020721 KIAA0914 gene product Down-regulated by Androgen T35365 EST Down-regulated by Androgen AF029789 Homo sapiens GTPase-activating protein (SIPA1) Down-regulated by Androgen mRNA, complete cds.
- SIPA1 Homo sapiens GTPase-activating protein
- AF070666 Homo sapiens tissue-type pituitary Kruppel- Down-regulated by Androgen associated box protein R55128 Proteasome (prosome, macropain) 26S subunit, non- Down-regulated by Androgen ATPase, 2 X75621 Tuberous sclerosis 2 Down-regulated by Androgen AA019070 EST Down-regulated by Androgen AI089867 EST Down-regulated by Androgen NM_001003 Homo sapiens ribosomal protein, large, P1 (RPLP1) Down-regulated by Androgen mRNA L05093 Ribosomal protein L18a Down-regulated by Androgen AA854176 EST Down-regulated by Androgen AI929622 Homo sapiens clone 23675 mRNA sequence Down-regulated by Androgen AI264769 ESTs, Weakly similar to ORF YDL087c Down-regulated by Androgen [ S.cerevisiae ] L09159 Ras
- X75861 Testis enhanced gene transcript Down-regulated by Androgen AA593078 Homo sapiens PAC clone DJ0167F23 from 7p15 Down-regulated by Androgen J04058 Human electron transfer flavoprotein alpha-subunit Down-regulated by Androgen mRNA AF026292 Homo sapiens chaperonin containing t-complex Down-regulated by Androgen polypeptide 1, eta AF068754 Homo sapiens heat shock factor binding protein 1 Down-regulated by Androgen HSBP1 mRNA, NM_000172 Guanine nucleotide binding protein (G protein), Down-regulated by Androgen alpha transducing activity polypeptide 1 AI140631 Hs.1915: folate hydrolase (prostate-specific Down-regulated by Androgen membrane antigen) 1
- Hs.118724 histidine triad nucleotide-binding protein, AJ012499, mRNA activated in tumor suppression, clone TSAP19 with polyA AA082804 zn41g02.r1
- Stratagene endothelial cell 937223 Homo sapiens cDNA, Hs.110967: ESTs, Weakly similar to KIAA0762 protein [ H.sapiens ], Hs.5662: guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 in the sequence no tag X05332 Human mRNA for prostate specific antigen.
- AI278854 qo42f01.x1 NCI_CGAP_Lu5
- Homo sapiens cDNA clone IMAGE 1911193 3′, NM_004537 nucleosome assembly protein 1-like
- NM_004540 Homo sapiens neural cell adhesion molecule 2 (NCAM2) AA151796 z139c02.r1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone NM_001634 Homo sapiens S-adenosylmethionine decarboxylase 1 (AMD1) NM_005013 Homo sapiens nucleobindin 2 (NUCB2)AL121913 in GenBank htgc database) and 718J7 (Accession number AL035541 AF004828 Homo sapiens rab3-GAP regulatory domain mRNA, complete cds.
- NCAM2 neural cell adhesion molecule 2
- AAD1 S-adenosylmethionine decarboxylase 1
- NUCB2 Homo sapiens nucleobindin 2
- 718J7 accesion number AL035541 AF004828 Homo sapiens rab3
- AF165967 Homo sapiens DDP-like protein mRNA X57129 H.sapiens H1.2 gene for histone H1. AA640928 nr28d08.r1
- NCI_CGAP_Pr3 Homo sapiens cDNA clone IMAGE:1169295, mRNA U41766 Human metalloprotease/disintegrin/cysteine-rich protein precursor
- AF023676 Homo sapiens lamin B receptor homolog TM7SF2 (TM7SF2) mRNA, U10691 Human MAGE-6 antigen (MAGE6) gene, complete cds.
- M22976 Human cytochrome b5 mRNA, 3′ end.
- AI204040 qe77f05.x1 Soares_fetal_lung_NbHL19W Homo sapiens cDNA clone AA577923 nl20a01.s1 NCI_CGAP_HSC1 Homo sapiens cDNA clone IMAGE:1041192, AA569633 nm38h09.s1 NCI_CGAP_Pr4.1 Homo sapiens cDNA clone IMAGE:1062497, U65011 Human preferentially expressed antigen of melanoma (PRAME) mRNA, U21910 Human basic transcription factor BTF2p44 mRNA, 3′ end, partial cds.
- PRAME Human preferentially expressed antigen of melanoma
- GATA2 Human GATA-binding protein
- AA310157 EST181013 Jurkat T-cells V Homo sapiens cDNA 5′ end, mRNA sequence. X00948 Human mRNA for prepro-relaxin H2. AB018330 Homo sapiens mRNA for KIAA0787 protein, partial cds. AA890637 ak11e11.s1 Soares_parathyroid_tumor_NbHPA Homo sapiens cDNA clone M64929 J05 Human protein phosphatase 2A alpha subunit mRNA, complete cds.
- Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone AF032887 Homo sapiens forkhead (FKHRL1P1) pseudogene N46609 yy48h08.r1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA U58855 Homo sapiens soluble guanylate cyclase large subunit (GC-S-alpha-1) AA255486 zr83d03.s1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:682277 AA128153 zl15c06.s1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone AA016039 ze31c05.s1 Soares retina N2b4HR Homo sapiens cDNA clone R88520
- Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:767345 5′ AI146806 qb83h04.x1 Soares_fetal_heart_NbHH19W Homo sapiens cDNA clone X82942 H.sapiens satellite 3 DNA.
- NM_000240 Homo sapiens monoamine oxidase A (MAOA) N34126 yx76c01.r1 Soares melanocyte 2NbHM Homo sapiens cDNA clone N41339 yw68g06.r1 Soares_placenta_8to9weeks_2NbHP8to9W Homo sapiens cDNA R34783 yh87b05.r1 Soares placenta Nb2HP Homo sapiens cDNA clone N75858 yw32a03.r1 Morton Fetal Cochlea Homo sapiens cDNA clone AA633887 ac32h04.s1 Stratagene hNT neuron (#937233) Homo sapiens cDNA clone N53723 yz06d03.r1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA AI187365 qf29b12.x1 Soares
- Prostate Specific PNAS 95, 300, 98 seminal plasma protein, nc50a10, microminderoprotein beta, PSP94 Hs.1852 PAP prostatic acid Prostate Specific PNAS, 95, 300, 98 phosphatase Hs.52871 SYT Prostate Specific PNAS, 95, 300, 98 Hs.158309 Homoobox HOX D13 Prostate Specific PNAS, 95, 300, 98 Hs.1968 Semenogelin 1 Prostate Specific PNAS, 95, 300, 98 Hs.76240 Adenylate kinase adenylate kinase 1 Prostate Specific PNAS, 95, 300, 98 isoenzyme 1 Hs.184376 SNAP23 Prostate Specific PNAS, 95, 300, 98 Hs.82186 ERBB-3 receptor Prostate Specific PNAS, 95, 300, 98 protein-tyrosin kinase Hs.18
- TACATTTTCA (SEQ ID NO: 28) 1/7 X85373 SNRPG, small nuclear RNP polypeptide G TCAGAACAGT (SEQ ID NO: 29) 1/7 NM_002092 GRSF-1, G-rich RNA binding factor 1 CAACTTCAAC (SEQ ID NO: 30) 0/5 NM_006451 PAIP1, poly A BP-interactimg protein 1 GATAGGTCGG (SEQ ID NO: 31) 0/5 Z11559 IREBP1, Iron-responsive element BP 1 CTAAAAGGAG (SEQ ID NO: 32) 2/10 M15919 SNRPE, small nuclear RNP polypeptide E Genomic Maintenance and Cell Cycle Regulation GTGGTGCGTG (SEQ ID NO: 33) 10/1 AF035587 XRCC2, X-ray repair protein 2 TCCCCGTGGC (SEQ ID NO: 34) 7/1 D13643 KIAA0018, Dimunuto-like ATTGATCTTG (SEQ ID NO: 35) 6/1 NM_002947
- serine/threonine kinase GGCCAGTAAC (SEQ ID NO: 64) 6/1 AL096857 similar to HAT2, integrin receptor AACTTAAGAG (SEQ ID NO: 65) 12/2 AB018330 calmodulin-dependent protein kinase kinase ⁇ AGGGATGGCC (SEQ ID NO: 66) 5/1 NM_006858 IL1RL1LG, Putative T1/ST2 receptor CTTAAGGATT (SEQ ID NO: 67) 2/10 AF151813 CGI-55 protein
- T/C represent the number of tags for each transcript in androgen treated (T) and control (C) LNCaP libraries. The differences in expression levels of genes identified by tags shown here were statistically significant (p ⁇ 0.05) as determined by the SAGE software.
- Bova G S and Issacs W B Review of allelic loss and gain in prostate cancer. World J Urol., 14:338-346, 1996.
- Veldscholte, J, R is-Stalpers C, Kulper G G J M, Jenster G, Berre-voets C, Classen E, Van Roooj H C J, Trapman J, Brinkmann A O, Mulder E.
- a mutation in the ligand binding domain of the androgen receptor of human LNCaP cells affects steroid binding characteristics and response to anti-androgens. Biochem. Biophys. Res. Commun., 173:534-540, 1990.
- Chromosome arm 20q gains and other genomic alterations in colorectal cancer metastatic to liver, as analyzed by comparative genomic hybridization and fluorescence in situ hybridization. Genes Chromosomes Cancer. 25: 82-90.
- VDAC voltage-dependent anion channel
Abstract
This invention relates to androgen-regulated nucleic acids, a polynucleotide array containing these androgen-regulated nucleic acids, and methods of using the polynucleotide array in the diagnosis and prognosis of prostate cancer.
Description
- The present application is based upon U.S. provisional applications S. Nos. 60/178,772, and 60/179,045, filed Jan. 28, 2000, and Jan. 31, 2000, respectively, priority to which is claimed under 35 U.S.C. §119(e). The entire disclosures of U.S. provisional applications S. Nos. 60/178,772, and 60/179,045, are expressly incorporated herein by reference.
- [0002] The invention described herein may be manufactured, licensed, and used for governmental purposes without payment of royalties to us thereon.
- The present invention relates to the quantitative evaluation of gene expression. More particularly, the present invention relates to novel, androgen-regulated nucleic acids, polynucleotide arrays containing these nucleic acids, and methods of using the array in the evaluation of hormone-related cancers, such as prostate cancer.
- Prostate cancer (CaP) is the most common malignancy in American men and second leading cause of cancer mortality (1). Serum-prostate specific antigen (PSA) tests have revolutionized the early detection of CaP (2). Although PSA has revolutionized early detection of prostate cancer, there is still a very high false positive rate. The increasing incidence of CaP has translated into wider use of radical prostatectomy as well as other therapies for localized disease (3-5). The wide spectrum of biologic behavior (6) exhibited by prostatic neoplasms poses a difficult problem in predicting the clinical course for the individual patient (3-5). Traditional prognostic markers such as grade, clinical stage, and pretreatment PSA have limited prognostic value for individual men (3-5). A more reliable technique for the evaluation and prognosis of CaP is desirable.
- Molecular studies have shown a significant heterogeneity between multiple cancer foci present in a cancerous prostate gland (7,8). These studies have also documented that the metastatic lesion can arise from cancer foci other than those present in dominant tumors (7). Approximately 50-60% of patients treated with radical prostatectomy for localized prostate carcinomas are found to have microscopic disease that is not organ-confined, and a significant portion of these patients relapse (9). Therefore, identification and characterization of genetic Iterations defining CaP onset and progression is crucial in understanding the biology and clinical course of the disease.
- Despite recent intensive research investigations, much remains to be learned about specific molecular defects associated with CaP onset and progression (6, 10-15). Alterations of the tumor suppressor gene p53, bcl-2 and the androgen receptor (AR), are frequently reported in advanced CaP (6, 10-15). However, the exact role of these genetic defects in the genesis and progression of CaP is poorly understood (6, 10-15). Recent studies have shown that the “focal p53 immunostaining” or bcl-2 immunostaining in radical prostatectomy specimens were independent prognostic markers for cancer recurrence after surgery (16-19). Furthermore, the combination of p53 and bcl-2 alterations was a stronger predictor of cancer recurrence after radical prostatectomy (18).
- The roles of several new chromosome loci harboring putative proto-oncogenes or tumor suppressor genes are being currently evaluated in CaP (7-13). High frequency of allelic losses on 8p21−22, 7q31.1, 10q23-25 and 16q24 loci have been shown in CaP (6, 10-15). PTEN1/MMAC1, a recently discovered tumor suppressor gene on chromosome 10q25, is frequently altered in advanced CaP (20, 21). Gains of chromosome 8q24 harboring c-myc and prostate stem-cell antigen (PSCA) genes have also been shown in prostate cancer (22, 23). Studies utilizing comparative genomic hybridization (CGH) have shown frequent losses of novel chromosomal loci including 2q, 5q and 6q and gains of 11p, 12q, 3q, 4q and 2p in CaP (24, 25). The inventors have recently mapped a 1.5 megabase interval at 6q 16-21 which may contain the putative tumor suppressor gene involved in a subset of prostate tumors. The risk for 6q LOH to non-organ confined disease was five fold higher than for organ confined disease (26). Chromosome regions, 1q24-25 and Xq27-28 have been linked to familial CaP (27, 28).
- It is evident that multiple molecular approaches need to be explored to identify CaP-associated genetic alterations. Emerging strategies for defining cancer specific genetic alterations and characterizing androgen regulated genes in rat prostate and LNCaP human prostate cancer cell models include, among others, the study of global gene expression profiles in cancer cells and corresponding normal cells by differential display (DD) (29) and more recent techniques, such as serial amplification of gene expression (SAGE) (30) and DNA micro-arrays (31; U.S. Pat. Nos. 5,744,305 and 5,837,832 which are herein incorporated by reference) followed by targeted analyses of promising candidates. Our laboratory has also employed DD, SAGE and DNA microarrays to study CaP associated gene expression alterations (32-33). Each of these techniques, however, is limited. The number of transcripts that can be analyzed is the major limitation encountered in subtractive hybridization and differential display approaches. Furthermore, while cDNA microarray approaches can determine expression of a large number of genes in a high throughput manner, the current limitations of cDNA arrays include the presence of specific arrays used for analyses and the inability to discover novel genes.
- While alterations of critical tumor-suppressor genes and oncogenes are important in prostate tumorogenesis, it is also recognized that hormonal mechanisms play equally important roles in prostate tumorogenesis. The cornerstone of therapy in patients with metastatic disease is androgen ablation, commonly referred to as “hormonal therapy (34),” which is dependent on the inhibition of androgen signaling in prostate cancer cells. Androgen ablation can be achieved, for example, by orchiectomy, by the administration of estrogen, or more recently by one of the luteinizing hormone-releasing hormone agonists. Recent clinical trials have demonstrated the efficacy of combining an antiandrogen to orchiectomy or a luteinizing hormone-releasing hormone to block the remaining androgens produced by the adrenal glands. Although approximately 80% of patients initially respond to hormonal ablation, the vast majority of patients eventually relapse (35), presumably due to neoplastic clones of cells which become refractory to this therapy.
- Alterations of the androgen receptor gene by mutations in the hormone binding domain of the AR or by amplification of the AR gene have been reported in advanced stages of CaP. Much remains to be learned, however, about the molecular mechanisms of the AR-mediated cell signaling in prostate growth and tumorogenesis (36-43). Our earlier studies have also described mutations of the AR in a subset of CaP (40). Mutations of the AR are reported to modify the ligand (androgen) binding of the AR by making the receptor promiscuous, so that it may bind to estrogen, progesterone, and related molecules, in addition to the androgens (36.38,42). Altered ligand binding specificity of the mutant AR may provide one of the mechanisms for increased function in cancer cells. Amplifications of the AR gene in hormone-refractory CaP represent yet another scenario where increase in AR function is associated with tumor progression (44,45).
- Several growth factors commonly involved in cell proliferation and tumorogenesis, e.g., IGF 1, EGF, and others, have been shown to activate the transcription transactivation functions of the AR (46). The co-activator of the AR transcription factor functions may also play a role in prostate cancer (47). Recent studies analyzing expression of the androgen-regulated genes (ARGs) in hormone sensitive and refractory CWR22 nude mice xenograft models (48) have also shown expression of several androgen regulated genes in AR positive recurrent tumors following castration, suggesting activation of AR in these tumors (49).
- In addition to the alterations of the androgen signaling pathway(s) in prostate tumor progression, androgen mechanisms are suspected to play a role in the predisposition to CaP. Prolonged administration of high levels of testosterone has been shown to induce CaP in rats (50-52). Although recent evidence suggests an association of androgen levels and risk of CaP, this specific observation remains to be established. (53). An independent line of investigations addressing the length of inherited polyglutamine (CAG) repeat sequence in the AR gene and CaP risk have shown that men with shorter repeats were at high risk of distant metastasis and fatal CaP (54,55). Moreover, the size distribution of AR CAG repeats in various ethnic groups has also suggested a possible relationship of shorter CAG repeats and increased prostate cancer risks in African-American men (56,57). Biochemical experiments evaluating AR-CAG repeat length and in vitro transcription transactivation functions of the AR revealed that AR with shorter CAG repeats possessed a more potent transcription trans-activation activity (58). Thus, molecular epidemiologic studies and biochemical experimentation suggest that gain of AR function, consequently resulting in transcriptional transactivation of downstream targets of the AR gene, may play an important role in CaP initiation. However, downstream targets of AR must be defined in order to understand the biologic basis of these observations.
- The biologic effects of androgen on target cells, e.g., prostatic epithelial cell proliferation and differentiation as well as the androgen ablation-induced cell death, are likely mediated by transcriptional regulation of ARGs by the androgen receptor (reviewed in 59). Abrogation of androgen signaling resulting from structural changes in the androgen gene or functional alterations of AR due to modulation of AR functions by other proteins would have profound effects on transcriptional regulation of genes regulated by AR and, thus, on the growth and development of the prostate gland, including abnormal growth characterized by benign prostatic hyperplasia and prostatic cancer. The nature of ARGs in the context of CaP initiation and progression, however, remains largely unknown. Since forced proliferation of the AR prostate cancer cells lacking AR induces cell-death related phenotypes (60), the studies utilizing AR expression via heterologous promoters in cell cultures have failed to address the observations relating to gain of AR functions and prostate cancer progression. Moreover, suitable animal models to assess gain of AR functions do not exist. Therefore, the expression profile of androgen responsive genes (ARGs) has potential to serve as read-out of the AR signaling status. Such a read-out may also define potential biomarkers for onset and progression of those prostate cancers which may involve abrogation of the androgen signaling pathway. Furthermore, functional analysis of androgen regulated genes will help understand the biochemical components of the androgen signaling pathways.
- The present invention relates to the identification and characterization of a novel androgen-regulated gene that exhibits abundant expression in prostate tissue. The novel gene has been designated PMEPA1. The invention provides the isolated nucleotide sequence of PMEPA1 or fragments thereof and nucleic acid sequences that hybridize to PMEPA1. These sequences have utility, for example, as markers of prostate cancer and other prostate-related diseases, and as targets for therapeutic intervention in prostate cancer and other prostate-related diseases. The invention further provides a vector that directs the expression of PMEPA1, and a host cell transfected or transduced with this vector.
- In another embodiment, the invention provides a method of detecting prostate cancer cells in a biological sample, for example, by using nucleic acid amplification techniques with primers and probes selected to bind specifically to the PMEPA1 sequence.
- In another aspect, the invention relates to an isolated polypeptide encoded by the PMEPA1 gene or a fragment thereof, and antibodies generated against the PMEPA1 polypeptide, peptides, or portions thereof, which can be used to detect, treat, and prevent prostate cancer.
- The present invention also relates to a polynucleotide array comprising (a) a planar, non-porous solid support having at least a first surface; and (b) a first set of polynucleotide probes attached to the first surface of the solid support, where the first set of polynuceotide probes comprises polynucleotide sequences derived from genes that are up-regulated, such as PMEPA1, or down-regulated in response to androgen, including genes downstream of the androgen receptor gene and genes upstream of the androgen receptor gene that modulate androgen receptor function. In another embodiment of the invention the polynucleotides immobilized on the solid support include genes that are known to be involved in testosterone biosynthesis and metabolism. In another embodiment of the invention the oligonucleotides immobilized on the solid support include genes whose expression is altered in prostate cancer or is specific to prostate tissue.
- In another embodiment, the invention provides a method for the diagnosis or prognosis of prostate cancer, comprising (a) hybridizing nucleic acids of a target cell of a patient with a polynucleotide array, as described above, to obtain a first hybridization pattern, where the first hybridization pattern represents an expression profile of androgen-regulated genes in the target cell; (b) comparing the first hybridization pattern of the target cell to a second hybridization pattern, where the second hybridization pattern represents an expression profile of androgen-regulated genes in prostate cancer, and (c) diagnosing or prognosing prostate cancer in the patient.
- Thus, a first aspect of the present invention is directed towards a method for analysis of radical prostatectomy specimens for the expression profile of those genes involved in androgen receptor-mediated signaling. In a preferred embodiment, computer models may be developed for the analysis of expression profiles. Another aspect of the invention is directed towards a method of correlating expression profiles with clinico-pathologic features. In a preferred embodiment, computer models to identify gene expression features associated with tumor phenotypes may be developed. Another aspect of the invention is directed towards a method of distinguishing indolent prostate cancers from those with a more aggressive phenotype. In a preferred embodiment, computer models to such cancers may be developed. Another aspect of the invention is directed towards a method of analyzing tumor specimens of patients treated by radical prostate surgery to help define prognosis. Another aspect of the invention is directed towards a method of screening candidate genes for the development of a blood test for improved prostate cancer detection. Another aspect of the invention is directed towards a method of identifying androgen regulated genes that may serve as biomarkers for response to treatment to screen drugs for the treatment of advanced prostate cancer.
- This invention is further directed to a method of identifying an expression profile of androgen-regulated genes in a target cell, comprising hybridizing the nucleic acids of the target cell with a polynucleotide array, as described above, to obtain a hybridization pattern, where the hybridization pattern represents the expression profile of androgen-regulated genes in the target cell.
- Additional features and advantages of the invention will be set forth in the description which follows, and in part will be apparent from the description, or may be learned by practice of the invention.
- FIG. 1 is a Northern blot showing that PMEPA1 is expressed at high levels in prostate tissue. Multiple tissue northern blots were hybridized with PMEPA1 and GAPDH probes. The arrows indicate the two variants of the PMEPA1 transcript.
- FIG. 2 shows the androgen-dependent expression of PMEPA1. FIG. 2A is a Northern blot using PMEPA1 probe with mRNA derived from LNCaP cells with or without R1881 treatment for various durations. FIG. 2B is a Northern blot of PMEPA1 expression in primary epithelial cell cultures of normal prostate and prostate and breast cancer cell lines.
- FIG. 3 shows PMEPA1 expression in CwR22 xenograft tumors.
Lane 1, sample from CWR22 tumor (androgen dependent). Lanes 2-5, samples from 4 individual CW2R tumors (AR positive but androgen independent). - The present invention provides a method useful in the diagnosis and prognosis of prostate cancer. An aspect of the invention provides a method to identify ARGs, such as PMEPA1, that exhibit stable transcriptional induction/repression in response to androgen and have potential as surrogate markers of the status of the androgen signaling in normal and cancerous epithelial cells of prostate.
- A second aspect of the invention provides for use of the expression profiles resulting from these methods in diagnostic methods, including, but not limited to, characterizing the treatment response to “hormonal therapy,” correlating expression profiles with clinico-pathologic features, distinguishing indolent prostate cancers from those with a more aggressive phenotype, analyzing tumor specimens of patients treated by radical prostate surgery to help define prognosis, screening candidate genes for the development of a polynucleotide array for use as a blood test for improved prostate cancer detection, and identifying androgen regulated genes that may serve as biomarkers for response to treatment to screen drugs for the treatment of advanced prostate cancer.
- As will be readily appreciated by persons having skill in the art, these gene sequences and ESTs described herein can easily be synthesized directly on a support, or pre-synthesized polynucleotide probes may be affixed to a support as described, for example, in U.S. Pat. Nos. 5,744,305, 5,837,832, and 5,861,242, each of which is incorporated herein by reference. Furthermore, such arrays may be made in a wide number of variations, combining, probes derived from sequences identified by the inventors as up-regulated or down-regulated in response to androgen and listed in Table 3 (genes and ESTs derived from the inventors' SAGE library that are up-regulated and down-regulated by androgens) with any of the sequences described in Table 4 (candidate genes and ESTs whose expression are potentially prostate specific or restricted), Table 5 (previously described genes and ESTs, including those associated with androgen signaling, prostate specificity, prostate cancer, and nuclear receptors/regulators with potential interaction with androgen receptors), Table 6 (genes and ESTs identified from the NIH CGAP database that are differentially expressed in prostate cancer), Table 7 (androgen regulated genes and ESTs derived from the CPDR Genome Systems ARG Database) and Table 8 (other genes associated with cancers). Tables 3-8 are located at the end of the specification at the end of the “Detailed Description” section and before the “References.” In Table 3, genes in bold type are known androgen-regulated genes based on Medline Search. In Table 4, genes in bold type are known prostate-specific genes.
- Such arrays may be used to detect specific nucleic acid sequences contained in a target cell or sample, as described in U.S. Pat. Nos. 5,744,305, 5,837,832, and 5,861,242, each of which is incorporated herein by reference. More specifically, in the present invention, these arrays may be used in methods for the diagnosis or prognosis of prostate cancer, such as by assessing the expression profiles of genes, derived from biological samples such as blood or tissues, that are up-regulated and down-regulated in response to androgen or otherwise involved in androgen receptor-mediated signaling. In a preferred embodiment, computer models may be developed for the analysis of expression profiles. Moreover, such polynucleotide arrays are useful in methods to screen drugs for the treatment of advanced prostate cancer. In these screening methods, the polynucleotide arrays are used to analyze how drugs affect the expression of androgen-regulated genes that are involved in prostate cancer.
- SAGE analysis. The SAGE technology is based on three main principles: 1) A short sequence tag (10-11 bp) is generated that contains sufficient information to identify a transcript, thus, each tag represents a signature sequence of a unique transcript; 2) many transcript tags can be concatenated into a single molecule and then sequenced, revealing the identity of multiple tags simultaneously; 3) quantitation of the number of times a particular tag is observed provides the expression level of the corresponding transcript (30). The schematic diagram and the details of SAGE procedure can be obtained from the web site: www.genzyme.com/SAGE.
- About fifty percent of SAGE tags identified by the inventors represent ESTs which need to be further analyzed for their protein coding capacity. The known genes up-regulated or down-regulated by four-fold (p<0.05) were broadly classified on the basis of the biochemical functions. SAGE tag defined ARGs were grouped under following categories: transcriptional regulators; RNA processing and translation regulators; protein involved in genomic maintenance and cell cycle; protein trafficking/chaperone proteins; energy metabolism, apoptosis and redox regulators; and signal transducers. As determined by PubMed database searches, a majority of genes listed in FIG. 3 have not been described as androgen regulated before. This is the first comprehensive list of the functionally defined genes regulated by androgen in the context of prostatic epithelial cells.
- Although promising candidate ARGs have been identified using these approaches, much remains to be learned about the complete repertoire of these genes. SAGE provides both quantitative and high throughput information with respect to global gene expression profiles of known as well as novel transcripts. We have performed SAGE analysis of the ARGs in the widely studied hormone responsive LNCaP prostate cancer cells treated with and without synthetic androgen, R1881. Of course, this SAGE technique could be repeated with hormones other than R1881, including other synthetic or natural androgens, such as dihydroxytestosterone, to potentially obtain a slightly different ARG expression panel. A goal of the inventors was to identify highly induced and repressed ARGs in LNCaP model which may define a panel of surrogate markers for the status androgen signaling in normal as well as cancerous prostate. Here, we report identification and analyses of a comprehensive database of SAGE tags corresponding to well-characterized genes, expressed sequence tags (ESTs) without any protein coding information and SAGE tags corresponding to novel transcripts. This is the first report describing a quantitative evaluation of the global gene expression profiles of the ARGs in the context of prostatic cancer cells by SAGE. We have further defined the ARGs on the basis of their known biologic/biochemical functions. Our study provides quantitative information on about 23,000 transcripts expressed in LNCaP cells, the most common cell line used in prostate cancer research. Finally, comparison of the LNCaP SAGE tag library and 35 SAGE tag libraries representing diverse cell type/tissues have unraveled a panel of genes whose expression are prostate specific or prostate abundant. Utilizing the LNCaP prostate cancer cells, the only well-characterized androgen responsive prostatic epithelial cells (normal or cancerous), we have identified a repertoire of androgen regulated genes by SAGE.
- Utilizing cell-culture systems and cell-signaling agents or exogenous expression of p53 and APC genes, SAGE technology has identified novel physiologically relevant transcriptional target genes which have unraveled new functions of p53 and APC genes (61-64). Our analysis of ARGs has provided identification and quantitative assessment of induction or repression of a global expression profile of ARGs in LNCaP cells. ARGs resulting from the mutational defects of the AR and those ARGs unaffected by AR mutations may be identified in this model system. Subsequent androgen regulation analysis of the selected ARGs in AR-positive, primary cultures of normal prostatic epithelial cells, and ARGs expression analysis in normal and tumor tissues will clarify normal or abnormal regulation of these ARGs. A panel of highly inducible/repressible ARGs identified by the inventors may provide bio-indicators of the AR transcription factor activity in physiologic context. These AR Function Bio-indicators (ARFBs) are useful in assessing the risk of CaP onset and/or progression. Moreover, identification or ARGs may also help in defining the therapeutic targets which could lead to effective treatment for hormone refractory cancer, currently a frustrating stage of the disease with limited therapeutic options.
- Characterization of a SAGE-defined EST that exhibited the highest level of induction in LNCaP cells responding to R1881 led to the discovery of a novel, androgen-induced gene, PMEPA1, which encodes a polypeptide with a type Ib transmembrane domain. A Protein sequence similarity search showed homology to C18orf1, a novel gene located on chromosome 18 that is mainly expressed in brain with multiple transcriptional variants (Yoshikawa et al., 1998). In addition to the sequence similarity, PMEPA1 also shares other features with C18orf1, e.g., similar size of the predicted protein and similar transmembrane domain as the β1 isoform of C18orf1. Therefore, it is likely that other isoforms of PMEPA1 may exist.
- Database searches showed that the PMEPA1 sequence matched to genomic clones RP5-1059L7 and 718J7 which were mapped to chromosome 20q13.2-13.33. Gain of 20q has been observed in many cancer types, including prostate, bladder, melanoma, colon, pancreas and breast (Brothman et al., 1990; Richter et al., 1998; Bastian et al., 1998; Kom et al., 1999; Mahlamaki et al., 1997; Tanner et al., 1996). Chromosome 20q gain was also observed during immortalization and may harbor genes involved in bypassing senescence (Jarrard et al., 1999; Cuthill et al., 1999). A differentially expressed gene in hormone refractory CaP, UEV-1, mapped to 20q13.2 (Stubbs et al., 1999). These observations indicate that one or several genes on chromosome 20q may be involved in prostate or other cancer progression. Although we did not observe increased expression of PMEPA1 in primary prostate tumors, increased PMEPA1 expression was noted in recurrent cancers of CWR22 xenograft.
- PMEPA1 expression is upregulated by androgens in a time- and concentration-specific manner in LNCaP cells. This observation underscores the potential of measuring PMEPA1 expression as one of the surrogate markers of androgen receptor activity in vivo in the epithelial cells of prostate tissue. Prostate cancer is androgen dependent and its growth in prostate is mediated by a network of ARGs that remains to be fully characterized. Most prostate cancers respond to androgen withdrawal but relapse after the initial response (Koivisto et al., 1998). The growth of the relapsed tumors is androgen independent even though tumors are positive for the expression of the AR (Bentel et al., 1996).
- One of the hypotheses of how cancer cells survive and grow in the low androgen environrment is the sensitization or the activation of the AR pathway (Jenster et al., 1999). Studies have shown increased expression of the ARGs or amplification of AR in androgen independent prostate cancer tissues (Gregory et al., 1998; Lin et al., 1999). We have observed that PMEPA1 was expressed in all CWR22R tumors and increased expression in three of four compared with CWR22 tumor. Our data support the concept that normally AR-dependent pathways remain activated, despite the absence of androgen in androgen-independent prostate cancer. There are only limited studies that have addressed whether ARGs play a role in the transition from androgen dependent tumor to androgen independent tumors. The high level of expression only in the prostate gland indicates that PMEPA1 might have important roles related to prostate cell biology or physiology. On the basis of homology of PMEPA1 to C18orf1 it is tempting to suggest that the PMEPA1 may belong to family of proteins involved in the binding of calcium and LDL.
- Characterization of genes like PMEPA1 is a step forward in the definition of the network of androgen regulated genes in prostate biology and tumorigenesis. In addition, ARGs, including PMEPA1, can be used as biomarkers of AR function readout in the subset of prostate cancers that may involve abrogation of androgen signaling. Furthermore, the newly defined ARGs have potential to identify novel targets in therapy of hormone refractory prostate cancer.
- The nucleic acid molecules encompassed in the invention include the following PMEPA1 nucleotide sequence:
ATGGCGGAGC TGGAGTTTGT TCAGATCATC ATCATCGTGG TGGTGATGAT 50 (SEQ ID NO. 2) GGTGATGGTG GTGGTGATCA CGTGCCTGCT GAGCCACTAC AAGCTGTCTG 100 CACGGTCCTT CATCAGCCGG CACAGCCAGG GGCGGAGGAG AGAAGATGCC 150 CTGTCCTCAG AAGGATGCCT GTGGCCCTCG GAGAGCACAG TGTCAGGCAA 200 CGGAATCCCA GAGCCGCAGG TCTACGCCCC GCCTCGGCCC ACCGACCGCC 250 TGGCCGTGCC GCCCTTCGCC CAGCGGGAGC GCTTCCACCG CTTCCAGCCC 300 ACCTATCCGT ACCTGCAGCA CGAGATCGAC CTGCCACCCA CCATCTCGCT 350 GTCAGACGGG GAGGAGCCCC CACCCTACCA GGGCCCCTGC ACCCTCCAGC 400 TTCGGGACCC CGAGCAGCAG CTGGAACTGA ACCGGGAGTC GGTGCGCGCA 450 CCCCCAAACA GAACCATCTT CGACAGTGAC CTGATGGATA GTGCCAGGCT 500 GGGCGGCCCC TGCCCCCCCA GCAGTAACTC GGGCATCAGC GCCACGTGCT 550 ACGGCAGCGG CGGGCGCATG GAGGGGCCGC CGCCCACCTA CAGCGAGGTC 600 ATCGGCCACT ACCCGGGGTC CTCCTTCCAG CACCAGCAGA GCAGTGGGCC 650 GCCCTCCTTG CTGGAGGGGA CCCGGCTCCA CCACACACAC ATCGCGCCCC 700 TAGAGAGCGC AGCCATCTGG AGCAAAGAGA AGGATAAACA GAAAGGACAC 750 CCTCTCTAG 759 - The amino acid sequences of the polypeptides encoded by the PMEPA1 nucleotide sequences of the invention include:
MAELEFVQII IIVVVMMVMV VVITCLLSHY KLSARSFISR HSQGRRREDA 50 (SEQ ID NO. 3) LSSEGCLWPS ESTVSGNGIP EPQVYAPPRP TDRLAVPPFA QRERFHRFQP 100 TYPYLQHEID LPPTISLSDG EEPPPYQGPC TLQLRDPEQQ LELNRESVRA 150 PPNRTIFDSD LMDSARLGGP CPPSSNSGIS ATCYGSGGRM EGPPPTYSEV 200 IGHYPGSSFQ HQQSSGPPSL LEGTRLHHTH IAPLESAAIW SKEKDKQKGH 250 PL* 252 - The discovery of the nucleic acids of the invention enables the construction of expression vectors comprising nucleic acid sequences encoding polypeptides; host cells transfected or transformed with the expression vectors; isolated and purified biologically active polypeptides and fragments thereof; the use of the nucleic acids or oligonucleotides thereof as probes to identify nucleic acid encoding proteins having PMEPA1-like activity; the use of single-stranded sense or antisense oligonucleotides from the nucleic acids to inhibit expression of polynucleotides encoded by the PMEPA1 gene; the use of such polypeptides and fragments thereof to generate antibodies; the use of the antibodies to purify PMEPA1 polypeptides; and the use of the nucleic acids, polypeptides, and antibodies of the invention to detect, prevent, and treat prostate cancer (e.g., prostatic intraepithelial neoplasia (PIN), adenocarcinomas, nodular hyperplasia, and large duct carcinomas) and prostate-related diseases (e.g., benign prostatic hyperplasia).
- Nucleic Acid Molecules
- In a particular embodiment, the invention relates to certain isolated nucleotide sequences that are free from contaminating endogenous material. A “nucleotide sequence” refers to a polynucleotide molecule in the form of a separate fragment or as a component of a larger nucleic acid construct. The nucleic acid molecule has been derived from DNA or RNA isolated at least once in substantially pure form and in a quantity or concentration enabling identification, manipulation, and recovery of its component nucleotide sequences by standard biochemical methods (such as those outlined in (Sambrook et al.,Molecular Cloning: A Laboratory Manual, 2nd ed., Cold Spring Harbor Laboratory, Cold Spring Harbor, N.Y. (1989)). Such sequences are preferably provided and/or constructed in the form of an open reading frame uninterrupted by internal non-translated sequences, or introns, that are typically present in eukaryotic genes. Sequences of non-translated DNA can be present 5′ or 3′ from an open reading frame, where the same do not interfere with manipulation or expression of the coding region.
- Nucleic acid molecules of the invention include DNA in both single-stranded and double-stranded form, as well as the RNA complement thereof. DNA includes, for example, cDNA, genomic DNA, chemically synthesized DNA, DNA amplified by PCR, and combinations thereof. Genomic DNA may be isolated by conventional techniques, e.g., using the cDNA of SEQ ID NO: 1, or a suitable fragment thereof, as a probe.
- The DNA molecules of the invention include full length genes as well as polynucleotides and fragments thereof. The full length gene may also include the N-terminal signal peptide. Other embodiments include DNA encoding a soluble form, e.g., encoding the extracellular domain of the protein, either with or without the signal peptide.
- The nucleic acids of the invention are preferentially derived from human sources, but the invention includes those derived from non-human species, as well.
- Preferred Sequences
- The particularly preferred nucleotide sequence of the invention is SEQ ID NO:2, as set forth above. The sequence of amino acids encoded by the DNA of SEQ ID NO:2 is shown in SEQ ID NO:3.
- Additional Sequences
- Due to the known degeneracy of the genetic code, where more than one codon can encode the same amino acid, a DNA sequence can vary from that shown in SEQ ID NO:2, and still encode a polypeptide having the amino acid sequence of SEQ ID NO:3. Such variant DNA sequences can result from silent mutations (e.g., occurring during PCR amplification), or can be the product of deliberate mutagenesis of a native sequence.
- The invention thus provides isolated DNA sequences encoding polypeptides of the invention, selected from: (a) DNA comprising the nucleotide sequence of SEQ ID NO:2; (b) DNA encoding the polypeptide of SEQ ID NO:3; (c) DNA capable of hybridization to a DNA of (a) or (b) under conditions of moderate stringency and which encodes polypeptides of the invention; (d) DNA capable of hybridization to a DNA of (a) or (b) under conditions of high stringency and which encodes polypeptides of the invention, and (e) DNA which is degenerate as a result of the genetic code to a DNA defined in (a), (b), (c), or (d) and which encode polypeptides of the invention. Of course, polypeptides encoded by such DNA sequences are encompassed by the invention.
- As used herein, conditions of moderate stringency can be readily determined by those having ordinary skill in the art based on, for example, the length of the DNA. The basic conditions are set forth by (Sambrook et al.Molecular Cloning: A Laboratory Manual, 2ed. Vol. 1, pp. 1.101-104, Cold Spring Harbor Laboratory Press, (1989)), and include use of a prewashing solution for the
nitrocellulose filters 5×SSC, 0.5% SDS, 1.0 mM EDTA (pH 8.0), hybridization conditions of about 50% formamide, 6×SSC at about 42° C. (or other similar ii hybridization solution, such as Stark's solution, in about 50% formamide at about 42° C.), and washing conditions of about 60° C., 0.5×SSC, 0.1% SDS. Conditions of high stringency can also be readily determined by the skilled artisan based on, for example, the length of the DNA. Generally, such conditions are defined as hybridization conditions as above, and with washing at approximately 68° C., 0.2×SSC, 0.1% SDS. The skilled artisan will recognize that the temperature and wash solution salt concentration can be adjusted as necessary according to factors such as the length of the probe. - Also included as an embodiment of the invention is DNA encoding polypeptide fragments and polypeptides comprising inactivated N-glycosylation site(s), inactivated protease processing site(s), or conservative amino acid substitution(s), as described below.
- In another embodiment, the nucleic acid molecules of the invention also comprise nucleotide sequences that are at least 80% identical to a native sequence. Also contemplated are embodiments in which a nucleic acid molecule comprises a sequence that is at least 90% identical, at least 95% identical, at least 98% identical, at least 99% identical, or at least 99.9% identical to a native sequence.
- The percent identity may be determined by visual inspection and mathematical calculation. Alternatively, the percent identity of two nucleic acid sequences can be determined by comparing sequence information using the GAP computer program, version 6.0 described by (Devereux et al.,Nucl. Acids Res., 12:387 (1984)) and available from the University of Wisconsin Genetics Computer Group (UWGCG). The preferred default parameters for the GAP program include: (1) a unary comparison matrix (containing a value of 1 for identities and 0 for non-identities) for nucleotides, and the weighted comparison matrix of (Gribskov and Burgess. Nucl. Acids Res., 14:6745 (1986)), as described by (Schwartz and Dayhoff, eds., Atlas of Protein Sequence and Structure, National Biomedical Research Foundation, pp. 353-358 (1979)); (2) a penalty of 3.0 for each gap and an additional 0.10 penalty for each symbol in each gap; and (3) no penalty for end gaps. Other programs used by one skilled in the art of sequence comparison may also be used.
- The invention also provides isolated nucleic acids useful in the production of polypeptides. Such polypeptides may be prepared by any of a number of conventional techniques. A DNA sequence encoding a PMEPA1 polypeptide, or desired fragment thereof may be subcloned into an expression vector for production of the polypeptide or fragment. The DNA sequence advantageously is fused to a sequence encoding a suitable leader or signal peptide. Alternatively, the desired fragment may be chemically synthesized using known techniques. DNA fragments also may be produced by restriction endonuclease digestion of a full length cloned DNA sequence, and isolated by electrophoresis on agarose gels. If necessary, oligonucleotides that reconstruct the 5′ or 3′ terminus to a desired point may be ligated to a DNA fragment generated by restriction enzyme digestion. Such oligonucleotides may additionally contain a restriction endonuclease cleavage site upstream of the desired coding sequence, and position an initiation codon (ATG) at the N-terminus of the coding sequence.
- The well-known polymerase chain reaction (PCR) procedure also may be used to isolate and amplify a DNA sequence encoding a desired protein fragment. Oligonucleotides that define the desired termini of the DNA fragment are employed as 5′ and 3′ primers. The oligonucleotides may additionally contain recognition sites for restriction endonucleases, to facilitate insertion of the amplified DNA fragment into an expression vector. PCR techniques are described in (Saiki et al.,Science, 239:487 (1988)); (Wu et al., Recombinant DNA Methodology, eds., Academic Press, Inc., San Diego, pp. 189-196 (1989)); and (Innis et al., PCR Protocols: A Guide to Methods and Applications, eds., Academic Press, Inc. (1990)).
- Polypeptides and Fragments Thereof
- The invention encompasses polypeptides and fragments thereof in various forms, including those that are naturally occurring or produced through various techniques such as procedures involving recombinant DNA technology. Such forms include, but are not limited to derivatives, variants, and oligomers, as well as fusion proteins or fragments thereof.
- Polypeptides and Fragments Thereof
- The polypeptides of the invention include full length proteins encoded by the nucleic acid sequences set forth above. Particularly preferred polypeptides comprise the amino acid sequence of SEQ ID NO:3.
- The polypeptides of the invention may be membrane bound or they may be secreted and thus soluble. Soluble polypeptides are capable of being secreted from the cells in which they are expressed. In general, soluble polypeptides may be identified (and distinguished from non-soluble membrane-bound counterparts) by separating intact cells which express the desired polypeptide from the culture medium, e.g., by centrifugation, and assaying the medium (supernatant) for the presence of the desired polypeptide. The presence of polypeptide in the medium indicates that the polypeptide was secreted from the cells and thus is a soluble form of the protein.
- In one embodiment, the soluble polypeptides and fragments thereof comprise all or part of the extracellular domain, but lack the transmembrane region that would cause retention of the polypeptide on a cell membrane. A soluble polypeptide may include the cytoplasmic domain, or a portion thereof, as long as the polypeptide is secreted from the cell in which it is produced.
- In general, the use of soluble forms is advantageous for certain applications. Purification of the polypeptides from recombinant host cells is facilitated, since the soluble polypeptides are secreted from the cells. Further, soluble polypeptides are generally more suitable for intravenous administration.
- The invention also provides polypeptides and fragments of the extracellular domain that retain a desired biological activity. Such a fragment may be a soluble polypeptide, as described above.
- Also provided herein are polypeptide fragments comprising at least 20, or at least 30, contiguous amino acids of the sequence of SEQ ID NO:3. Fragments derived from the cytoplasmic domain find use in studies of signal transduction, and in regulating cellular processes associated with transduction of biological signals. Polypeptide fragments also may be employed as immunogens, in generating antibodies.
- Variants
- Naturally occurring variants as well as derived variants of the polypeptides and fragments are provided herein.
- Variants may exhibit amino acid sequences that are at least 80% identical. Also contemplated are embodiments in which a polypeptide or fragment comprises an amino acid sequence that is at least 90% identical, at least 95% identical, at least 98% identical, at least 99% identical, or at least 99.9% identical to the preferred polypeptide or fragment thereof. Percent identity may be determined by visual inspection and mathematical calculation. Alternatively, the percent identity of two protein sequences can be determined by comparing sequence information using the GAP computer program, based on the algorithm of (Needleman and Wunsch,J. Mol. Bio., 48:443 (1970)) and available from the University of Wisconsin Genetics Computer Group (UWGCG). The preferred default parameters for the GAP program include: (1) a scoring matrix, blosum62, as described by (Henikoff and Henikoff Proc. Natl. Acad. Sci. USA, 89:10915 (1992)); (2) a gap weight of 12; (3) a gap length weight of 4; and (4) no penalty for end gaps. Other programs used by one skilled in the art of sequence comparison may also be used.
- The variants of the invention include, for example, those that result from alternate mRNA splicing events or from proteolytic cleavage. Alternate splicing of mRNA may, for example, yield a truncated but biologically active protein, such as a naturally occurring soluble form of the protein. Variations attributable to proteolysis include, for example, differences in the N- or C-termini upon expression in different types of host cells, due to proteolytic removal of one or more terminal amino acids from the protein (generally from 1-5 terminal amino acids). Proteins in which differences in amino acid sequence are attributable to genetic polymorphism (allelic variation among individuals producing the protein) are also contemplated herein.
- Additional variants within the scope of the invention include polypeptides that may be modified to create derivatives thereof by forming covalent or aggregative conjugates with other chemical moieties, such as glycosyl groups, lipids, phosphate, acetyl groups and the like. Covalent derivatives may be prepared by linking the chemical moieties to functional groups on amino acid side chains or at the N-terminus or C-terminus of a polypeptide. Conjugates comprising diagnostic (detectable) or therapeutic agents attached thereto are contemplated herein, as discussed in more detail below.
- Other derivatives include covalent or aggregative conjugates of the polypeptides with other proteins or polypeptides, such as by synthesis in recombinant culture as N-terminal or C-terminal fusions. Examples of fusion proteins are discussed below in connection with oligomers. Further, fusion proteins can comprise peptides added to facilitate purification and identification. Such peptides include, for example, poly-His or the antigenic identification peptides described in U.S. Pat. No. 5,011,912 and in (Hopp et al.,Bio/Technology, 6:1204 (1988)). One such peptide is the FLAG® peptide, Asp-Tyr-Lys-Asp-Asp-Asp-Asp-Lys, (SEQ ID NO:4) which is highly antigenic and provides an epitope reversibly bound by a specific monoclonal antibody, enabling rapid assay and facile purification of expressed recombinant protein. A murine hybridoma designated 4E 11 produces a monoclonal antibody that binds the FLAG® peptide in the presence of certain divalent metal cations, as described in U.S. Pat. No. 5,011,912, hereby incorporated by reference. The 4E11 hybridoma cell line has been deposited with the American Type Culture Collection under accession no. HB 9259. Monoclonal antibodies that bind the FLAG® peptide are available from Eastman Kodak Co., Scientific Imaging Systems Division, New Haven, Conn.
- Among the variant polypeptides provided herein are variants of native polypeptides that retain the native biological activity or the substantial equivalent thereof. One example is a variant that binds with essentially the same binding affinity as does the native form. Binding affinity can be measured by conventional procedures, e.g., as described in U.S. Pat. No. 5,512,457 and as set forth below.
- Variants include polypeptides that are substantially homologous to the native form, but which have an amino acid sequence different from that of the native form because of one or more deletions, insertions or substitutions. Particular embodiments include, but are not limited to, polypeptides that comprise from one to ten deletions, insertions or substitutions of amino acid residues, when compared to a native sequence.
- A given amino acid may be replaced, for example, by a residue having similar physiochemical characteristics. Examples of such conservative substitutions include substitution of one aliphatic residue for another, such as Ile, Val, Leu, or Ala for one another; substitutions of one polar residue for another, such as between Lys and Arg, Glu and Asp, or Gin and Asn; or substitutions of one aromatic residue for another, such as Phe, Trp, or Tyr for one another. Other conservative substitutions, e.g., involving substitutions of entire regions having similar hydrophobicity characteristics, are well known.
- Similarly, the DNAs of the invention include variants that differ from a native DNA sequence because of one or more deletions, insertions or substitutions, but that encode a biologically active polypeptide.
- The invention further includes polypeptides of the invention with or without associated native-pattern glycosylation. Polypeptides expressed in yeast or mammalian expression systems (e.g., COS-1 or COS-7 cells) can be similar to or significantly different from a native polypeptide in molecular weight and glycosylation pattern, depending upon the choice of expression system. Expression of polypeptides of the invention in bacterial expression systems, such asE. Coli, provides non-glycosylated molecules. Further, a given preparation may include multiple differentially glycosylated species of the protein. Glycosyl groups can be removed through conventional methods, in particular those utilizing glycopeptidase. In general, glycosylated polypeptides of the invention can be incubated with a molar excess of glycopeptidase (Boehringer Mannheim).
- Correspondingly, similar DNA constructs that encode various additions or substitutions of amino acid residues or sequences, or deletions of terminal or internal residues or sequences are encompassed by the invention. For example, N-glycosylation sites in the polypeptide extracellular domain can be modified to preclude glycosylation, allowing expression of a reduced carbohydrate analog in mammalian and yeast expression systems. N-glycosylation sites in eukaryotic polypeptides are characterized by an amino acid triplet Asn-X-Y, wherein X is any amino acid and Y is Ser or Thr. Appropriate substitutions, additions, or deletions to the nucleotide sequence encoding these triplets will result in prevention of attachment of carbohydrate residues at the Asn side chain. Alteration of a single nucleotide, chosen so that Asn is replaced by a different amino acid, for example, is sufficient to inactivate an N-glycosylation site. Alternatively, the Ser or Thr can by replaced with another amino acid, such as Ala. Known procedures for inactivating N-glycosylation sites in proteins include those described in U.S. Pat. No. 5,071,972 and EP 276,846, hereby incorporated by reference.
- In another example of variants, sequences encoding Cys residues that are not essential for biological activity can be altered to cause the Cys residues to be deleted or replaced with other amino acids, preventing formation of incorrect intramolecular disulfide bridges upon folding or renaturation.
- Other variants are prepared by modification of adjacent dibasic amino acid residues, to enhance expression in yeast systems in which KEX2 protease activity is present. EP 212,914 discloses the use of site-specific mutagenesis to inactivate KEX2 protease processing sites in a protein. KEX2 protease processing sites are inactivated by deleting, adding or substituting residues to alter Arg-Arg, Arg-Lys, and Lys-Arg pairs to eliminate the occurrence of these adjacent basic residues. Lys-Lys pairings are considerably less susceptible to KEX2 cleavage, and conversion of Arg-Lys or Lys-Arg to Lys-Lys represents a conservative and preferred approach to inactivating KEX2 sites.
- Production of Polypeptides and Fragments Thereof
- Expression, isolation and purification of the polypeptides and fragments of the invention may be accomplished by any suitable technique, including but not limited to the following:
- Expression Systems
- The present invention also provides recombinant cloning and expression vectors containing DNA, as well as host cell containing the recombinant vectors. Expression vectors comprising DNA may be used to prepare the polypeptides or fragments of the invention encoded by the DNA. A method for producing polypeptides comprises culturing host cells transformed with a recombinant expression vector encoding the polypeptide, under conditions that promote expression of the polypeptide, then recovering the expressed polypeptides from the culture. The skilled artisan will recognize that the procedure for purifying the expressed polypeptides will vary according to such factors as the type of host cells employed, and whether the polypeptide is membrane-bound or a soluble form that is secreted from the host cell.
- Any suitable expression system may be employed. The vectors include a DNA encoding a polypeptide or fragment of the invention, operably linked to suitable transcriptional or translational regulatory nucleotide sequences, such as those derived from a mammalian, microbial, viral, or insect gene. Examples of regulatory sequences include transcriptional promoters, operators, or enhancers, an mRNA ribosomal binding site, and appropriate sequences which control transcription and translation initiation and termination. Nucleotide sequences are operably linked when the regulatory sequence functionally relates to the DNA sequence. Thus, a promoter nucleotide sequence is operably linked to a DNA sequence if the promoter nucleotide sequence controls the transcription of the DNA sequence. An origin of replication that confers the ability to replicate in the desired host cells, and a selection gene by which transformants are identified, are generally incorporated into the expression vector.
- In addition, a sequence encoding an appropriate signal peptide (native or heterologous) can be incorporated into expression vectors. A DNA sequence for a signal peptide (secretory leader) may be fused in frame to the nucleic acid sequence of the invention so that the DNA is initially transcribed, and the mRNA translated, into a fusion protein comprising the signal peptide. A signal peptide that is functional in the intended host cells promotes extracellular secretion of the polypeptide. The signal peptide is cleaved from the polypeptide upon secretion of polypeptide from the cell.
- Suitable host cells for expression of polypeptides include prokaryotes, yeast or higher eukaryotic cells. Mammalian or insect cells are generally preferred for use as host cells. Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts are described, for example, in (Pouwels et al.Cloning Vectors: A Laboratory Manual, Elsevier, New York, (1985)). Cell-free translation systems could also be employed to produce polypeptides using RNAs derived from DNA constructs disclosed herein.
- Prokaryotic Systems
- Prokaryotes include gram-negative or gram-positive organisms. Suitable prokaryotic host cells for transformation include, for example,E. coli, Bacillus subtilis, Salmonella typhimurium, and various other species within the genera Pseudomonas, Streptomyces, and Staphylococcus. In a prokaryotic host cell, such as E. coli, a polypeptide may include an N-terminal methionine residue to facilitate expression of the recombinant polypeptide in the prokaryotic host cell. The N-terminal Met may be cleaved from the expressed recombinant polypeptide.
- Expression vectors for use in prokaryotic host cells generally comprise one or more phenotypic selectable marker genes. A phenotypic selectable marker gene is, for example, a gene encoding a protein that confers antibiotic resistance or that supplies an autotrophic requirement. Examples of useful expression vectors for prokaryotic host cells include those derived from commercially available plasmids such as the cloning vector pBR322 (ATCC 37017). pBR322 contains genes for ampicillin and tetracycline resistance and thus provides simple means for identifying transformed cells. An appropriate promoter and a DNA sequence are inserted into the pBR322 vector. Other commercially available vectors include, for example, pKK223-3 (Pharmacia Fine Chemicals, Uppsala, Sweden) and pGEM1 (Promega Biotec, Madison, Wis., USA).
- Promoter sequences commonly used for recombinant prokaryotic host cell expression vectors include β-lactamase (penicillinase), lactose promoter system (Chang et al.,Nature 275:615 (1978); and (Goeddel et al., Nature 281:544 (1979)), tryptophan (trp) promoter system (Goeddel et al., Nucl. Acids Res. 8:4057 (1980); and EP-A-36776) and tac promoter (Maniatis, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, p. 412 (1982)). A particularly useful prokaryotic host cell expression system employs a phage λPL promoter and a cI857ts thermolabile repressor sequence. Plasmid vectors available from the American Type Culture Collection which incorporate derivatives of the λPL promoter include plasmid pHUB2 (resident in E. coli strain JMB9, ATCC 37092) and pPLc28 (resident in E. coli RR1, ATCC 53082).
- Yeast Systems
- Alternatively, the polypeptides may be expressed in yeast host cells, preferably from the Saccharomyces genus (e.g.,S. cerevisiae). Other genera of yeast, such as Pichia or Kluyveromyces, may also be employed. Yeast vectors will often contain an origin of replication sequence from a 2 μ yeast plasmid, an autonomously replicating sequence (ARS), a promoter region, sequences for polyadenylation, sequences for transcription termination, and a selectable marker gene. Suitable promoter sequences for yeast vectors include, among others, promoters for metallothionein, 3-phosphoglycerate kinase (Hitzeman et al., J. Biol. Chem. 255:2073 (1980)) or other glycolytic enzymes (Hess et al., J. Adv. Enzyme Reg. 7:149 (1968)); and (Holland et al., Biochem. 17:4900 (1978)), such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase. Other suitable vectors and promoters for use in yeast expression are further described in (Hitzeman, EPA-73,657). Another alternative is the glucose-repressible ADH2 promoter described by (Russell et al., J. Biol. Chem. 258:2674 (1982)) and (Beier et al., Nature 300:724 (1982)). Shuttle vectors replicable in both yeast and E. coli may be constructed by inserting DNA sequences from pBR322 for selection and replication in E. coli (Ampr gene and origin of replication) into the above-described yeast vectors.
- The yeast a-factor leader sequence may be employed to direct secretion of the polypeptide. The α-factor leader sequence is often inserted between the promoter sequence and the structural gene sequence. See, e.g., (Kurjan et al.,Cell 30:933 (1982)) and (Bitter et al., Proc. Natl. Acad. Sci. USA 81:5330 (1984)). Other leader sequences suitable for facilitating secretion of recombinant polypeptides from yeast hosts are known to those of skill in the art. A leader sequence may be modified near its 3′ end to contain one or more restriction sites. This will facilitate fusion of the leader sequence to the structural gene.
- Yeast transformation protocols are known to those of skill in the art. One such protocol is described by (Hinnen et al.,Proc. Natl. Acad. Sci. USA 75:1929 (1978)). The Hinnen et al. protocol selects for Trp+ transformants in a selective medium, wherein the selective medium consists of 0.67% yeast nitrogen base, 0.5% casamino acids, 2% glucose, 10 mg/ml ademne and 20 mg/ml uracil.
- Yeast host cells transformed by vectors containing an ADH2 promoter sequence may be grown for inducing expression in a “rich” medium. An example of a rich medium is one consisting of 1% yeast extract, 2% peptone, and 1% glucose supplemented with 80 mg/ml adenine and 80 mg/ml uracil. Derepression of the ADH2 promoter occurs when glucose is exhausted from the medium.
- Mammalian or Insect Systems
- Mammalian or insect host cell culture systems also may be employed to express recombinant polypeptides. Bacculovirus systems for production of heterologous proteins in insect cells are reviewed by (Luckow and Summers,Bio/Technology, 6:47 (1988)). Established cell lines of mammalian origin also may be employed. Examples of suitable mammalian host cell lines include the COS-7 line of monkey kidney cells (ATCC CRL 1651) (Gluzman et al., Cell 23:175 (1981)), L cells, C127 cells, 3T3 cells (ATCC CCL 163), Chinese hamster ovary (CHO) cells, HeLa cells, and BHK (ATCC CRL 10) cell lines, and the CV1/EBNA cell line derived from the African green monkey kidney cell line CV1 (ATCC CCL 70) as described by (McMahan et al., EMBO J., 10: 2821 (1991)).
- Established methods for introducing DNA into mammalian cells have been described (Kaufman, R. J.,Large Scale Mammalian Cell Culture, pp. 15-69 (1990)). Additional protocols using commercially available reagents, such as Lipofectamine lipid reagent (Gibco/BRL) or Lipofectamine-Plus lipid reagent, can be used to transfect cells (Felgner et al., Proc. Natl. Acad. Sci. USA 84:7413-7417 (1987)). In addition, electroporation can be used to transfect mammalian cells using conventional procedures, such as those in (Sambrook et al., Molecular Cloning: A Laboratory Manual, 2 ed. Vol. 1-3, Cold Spring Harbor Laboratory Press (1989)). Selection of stable transformants can be performed using methods known in the art, such as, for example, resistance to cytotoxic drugs. (Kaufman et al., Meth. in Enzymology 185:487-511 (1990)), describes several selection schemes, such as dihydrofolate reductase (DHFR) resistance. A suitable host strain for DHFR selection can be CHO strain DX-B 11, which is deficient in DHFR (Urlaub and Chasin, Proc. Natl. Acad. Sci. USA 77:4216-4220 (1980)). A plasmid expressing the DHFR cDNA can be introduced into strain DX-B11, and only cells that contain the plasmid can grow in the appropriate selective media. Other examples of selectable markers that can be incorporated into an expression vector include cDNAs conferring resistance to antibiotics, such as G418 and hygromycin B. Cells harboring the vector can be selected on the basis of resistance to these compounds.
- Transcriptional and translational control sequences for mammalian host cell expression vectors can be excised from viral genomes. Commonly used promoter sequences and enhancer sequences are derived from polyoma virus,
adenovirus 2, simian virus 40 (SV40), and human cytomegalovirus. DNA sequences derived from the SV40 viral genome, for example, SV40 origin, early and late promoter, enhancer, splice, and polyadenylation sites can be used to provide other genetic elements for expression of a structural gene sequence in a mammalian host cell. Viral early and late promoters are particularly useful because both are easily obtained from a viral genome as a fragment, which can also contain a viral origin of replication (Fiers et al. Nature 273:113 (1978)); (Kaufman, Meth. in Enzymology (1990)). Smaller or larger SV40 fragments can also be used, provided the approximately 250 bp sequence extending from the Hind III site toward the Bgl I site located in the SV40 viral origin of replication site is included. - Additional control sequences shown to improve expression of heterologous genes from mammalian expression vectors include such elements as the expression augmenting sequence element (EASE) derived from CHO cells (Morris et al.,Animal Cell Technology, pp. 529-53.4 and PCT Application WO 97/25420 (1997)) and the tripartite leader (TPL) and VA gene RNAs from Adenovirus 2 (Gingeras et al., J. Biol. Chem. 257:13475-13491 (1982)). The internal ribosome entry site (IRES) sequences of viral origin allows dicistronic mRNAs to be translated efficiently (Oh and Sarnow, Current Opinion in Genetics and Development 3:295-300 (1993)); (Ramesh et al., Nucleic Acids Research 24:2697-2700 (1996)). Expression of a heterologous cDNA as part of a dicistronic mRNA followed by the gene for a selectable marker (e.g. DHFR) has been shown to improve transfectability of the host and expression of the heterologous cDNA (Kaufman, Meth. in Enzymology (1990)). Exemplary expression vectors that employ dicistronic mRNAs are pTR-DC/GFP described by (Mosser et al., Biotechniques 22:150-161 (1997)), and p2A5I described by (Morris et al., Animal Cell Technology, pp. 529-534 (1997)).
- A useful high expression vector, pCAVNOT, has been described by (Mosley et al.,Cell 59:335-348 (1989)). Other expression vectors for use in mammalian host cells can be constructed as disclosed by (Okayama and Berg, Mol. Cell. Biol. 3:280 (1983)). A useful system for stable high level expression of mammalian cDNAs in C127 murine mammary epithelial cells can be constructed substantially as described by (Cosman et al., Mol. Immunol. 23:935 (1986)). A useful high expression vector, PMLSV N1/N4, described by (Cosman et al., Nature 312:768 (1984)), has been deposited as ATCC 39890. Additional useful mammalian expression vectors are described in EP-A-0367566, and in WO 91/18982, incorporated by reference herein. In yet another alternative, the vectors can be derived from retroviruses.
- Another useful expression vector, pFLAG®, can be used. FLAG® technology is centered on the fusion of a low molecular weight (1 kD), hydrophilic, FLAG® marker peptide to the N-terminus of a recombinant protein expressed by pFLAG® expression vectors. pDC311 is another specialized vector used for expressing proteins in CHO cells. pDC311 is characterized by a bicistronic sequence containing the gene of interest and a dihydrofolate reductase (DHFR) gene with an internal ribosome binding site for DHFR translation, an expression augmenting sequence element (EASE), the human CMV promoter, a tripartite leader sequence, and a polyadenylation site.
- Purification
- The invention also includes methods of isolating and purifying the polypeptides and fragments thereof.
- Isolation and Purification
- The “isolated” polypeptides or fragments thereof encompassed by this invention are polypeptides or fragments that are not in an environment identical to an environment in which it or they can be found in nature. The “purified” polypeptides or fragments thereof encompassed by this invention are essentially free of association with other proteins or polypeptides, for example, as a purification product of recombinant expression systems such as those described above or as a purified product from a non-recombinant source such as naturally occurring cells and/or tissues.
- In one preferred embodiment, the purification of recombinant polypeptides or fragments can be accomplished using fusions of polypeptides or fragments of the invention to another ii polypeptide to aid in the purification of polypeptides or fragments of the invention.
- With respect to any type of host cell, as is known to the skilled artisan, procedures for purifying a recombinant polypeptide or fragment will vary according to such factors as the type of host cells employed and whether or not the recombinant polypeptide or fragment is secreted into the culture medium.
- In general, the recombinant polypeptide or fragment can be isolated from the host cells if not secreted, or from the medium or supernatant if soluble and secreted, followed by one or more concentration, salting-out, ion exchange, hydrophobic interaction, affinity purification or size exclusion chromatography steps. As to specific ways to accomplish these steps, the culture medium first can be concentrated using a commercially available protein concentration filter, for example, an Amicon or Millipore Pellicon ultrafiltration unit. Following the concentration step, the concentrate can be applied to a purification matrix such as a gel filtration medium. Alternatively, an anion exchange resin can be employed, for example, a matrix or substrate having pendant diethylaminoethyl (DEAE) groups. The matrices can be acrylamide, agarose, dextran, cellulose or other types commonly employed in protein purification. Alternatively, a cation exchange step can be employed. Suitable cation exchangers include various insoluble matrices comprising sulfopropyl or carboxymethyl groups. In addition, a chromatofocusing step can be employed. Alternatively, a hydrophobic interaction chromatography step can be employed. Suitable matrices can be phenyl or octyl moieties bound to resins. In addition, affinity chromatography with a matrix which selectively binds the recombinant protein can be employed. Examples of such resins employed are lectin columns, dye columns, and metal-chelating columns. Finally, one or more reversed-phase high performance liquid chromatography (RP-HPLC) steps employing hydrophobic RP-HPLC media, (e.g., silica gel or polymer resin having pendant methyl, octyl, octyldecyl or other aliphatic groups) can be employed to further purify the polypeptides. Some or all of the foregoing purification steps, in various combinations, are well known and can be employed to provide an isolated and purified recombinant protein.
- It is also possible to utilize an affinity column comprising a polypeptide-binding protein of the invention, such as a monoclonal antibody generated against polypeptides of the invention, to affinity-purify expressed polypeptides. These polypeptides can be removed from an affinity column using conventional techniques, e.g., in a high salt elution buffer and then dialyzed into a lower salt buffer for use or by changing pH or other components depending on the affinity matrix utilized, or be competitively removed using the naturally occurring substrate of the affinity moiety, such as a polypeptide derived from the invention.
- In this aspect of the invention, polypeptide-binding proteins, such as the anti-polypeptide antibodies of the invention or other proteins that may interact with the polypeptide of the invention, can be bound to a solid phase support such as a column chromatography matrix or a similar substrate suitable for identifying, separating, or purifying cells that express polypeptides of the invention on their surface. Adherence of polypeptide-binding proteins of the invention to a solid phase contacting surface can be accomplished by any means, for example, magnetic microspheres can be coated with these polypeptide-binding proteins and held in the incubation vessel through a magnetic field. Suspensions of cell mixtures are contacted with the solid phase that has such polypeptide-binding proteins thereon. Cells having polypeptides of the invention on their surface bind to the fixed polypeptide-binding protein and unbound cells then are washed away. This affinity-binding method is useful for purifying, screening, or separating such polypeptide-expressing cells from solution. Methods of releasing positively selected cells from the solid phase are known in the art and encompass, for example, the use of enzymes. Such enzymes are preferably non-toxic and non-injurious to the cells and are preferably directed to cleaving the cell-surface binding partner.
- Alternatively, mixtures of cells suspected of containing polypeptide-expressing cells of the invention first can be incubated with a biotinylated polypeptide-binding protein of the invention. Incubation periods are typically at least one hour in duration to ensure sufficient binding to polypeptides of the invention. The resulting mixture then is passed through a column packed with avidin-coated beads, whereby the high affinity of biotin for avidin provides the binding of the polypeptide-binding cells to the beads. Use of avidin-coated beads is known in the art. See (Berenson, et al.J. Cell. Biochem., 10D:239 (1986)). Wash of unbound material and the release of the bound cells is performed using conventional methods.
- The desired degree of purity depends on the intended use of the protein. A relatively high degree of purity is desired when the polypeptide is to be administered in vivo, for example. In such a case, the polypeptides are purified such that no protein bands corresponding to other proteins are detectable upon analysis by SDS-polyacrylamide gel electrophoresis (SDS-PAGE). It will be recognized by one skilled in the pertinent field that multiple bands corresponding to the polypeptide may be visualized by SDS-PAGE, due to differential glycosylation, differential post-translational processing, and the like. Most preferably, the polypeptide of the invention is purified to substantial homogeneity, as indicated by a single protein band upon analysis by SDS-PAGE. The protein band may be visualized by silver staining, Coomassie blue staining, or (if the protein is radiolabeled) by autoradiography.
- Production of Antibodies
- Antibodies that are immunoreactive with the polypeptides of the invention are provided herein. Such antibodies specifically bind to the polypeptides via the antigen-binding sites of the antibody (as opposed to non-specific binding). Thus, the polypeptides, fragments, variants, fusion proteins, etc., as set forth above may be employed as “immunogens” in producing antibodies immunoreactive therewith. More specifically, the polypeptides, fragment, variants, fusion proteins, etc. contain antigenic determinants or epitopes that elicit the formation of antibodies.
- These antigenic determinants or epitopes can be either linear or conformational (discontinuous). Linear epitopes are composed of a single section of amino acids of the polypeptide, while conformational or discontinuous epitopes are composed of amino acids sections from different regions of the polypeptide chain that are brought into close proximity upon protein folding (C. A. Janeway, Jr. and P. Travers,Immuno Biology 3:9, Garland Publishing Inc., 2nd ed. (1996)). Because folded proteins have complex surfaces, the number of epitopes available is quite numerous; however, due to the conformation of the protein and steric hinderances, the number of antibodies that actually bind to the epitopes is less than the number of available epitopes (C. A. Janeway, Jr. and P. Travers, Immuno Biology 2:14, Garland Publishing Inc., 2nd ed. (1996)). Epitopes may be identified by any of the methods known in the art.
- Thus, one aspect of the present invention relates to the antigenic epitopes of the polypeptides of the invention. Such epitopes are useful for raising antibodies, in particular monoclonal antibodies, as described in more detail below. Additionally, epitopes from the polypeptides of the invention can be used as research reagents, in assays, and to purify specific binding antibodies from substances such as polyclonal sera or supernatants from cultured hybridomas. Such epitopes or variants thereof can be produced using techniques well known in the art such as solid-phase synthesis, chemical or enzymatic cleavage of a polypeptide, or using recombinant DNA technology.
- As to the antibodies that can be elicited by the epitopes of the polypeptides of the invention, whether the epitopes have been isolated or remain part of the polypeptides, both polyclonal and monoclonal antibodies may be prepared by conventional techniques. See, for example, (Kennet et al.,Monoclonal Antibodies, Hybridomas: A New Dimension in Biological Analyses, eds., Plenum Press, New York (1980); and Harlow and Land, Antibodies: A Laboratory Manual, eds., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., (1988)).
- Hybridoma cell lines that produce monoclonal antibodies specific for the polypeptides of the invention are also contemplated herein. Such hybridomas may be produced and identified by conventional techniques. One method for producing such a hybridoma cell line comprises immunizing an animal with a polypeptide; harvesting spleen cells from the immunized animal; fusing said spleen cells to a myeloma cell line, thereby generating hybridoma cells; and identifying a hybridoma cell line that produces a monoclonal antibody that binds the polypeptide. The monoclonal antibodies may be recovered by conventional techniques.
- The monoclonal antibodies of the present invention include chimeric antibodies, e.g., humanized versions of murine monoclonal antibodies. Such humanized antibodies may be prepared by known techniques and offer the advantage of reduced immunogenicity when the antibodies are administered to humans. In one embodiment, a humanized monoclonal antibody comprises the variable region of a murine antibody (or just the antigen binding site thereof) and a constant region derived from a human antibody. Alternatively, a humanized antibody fragment may comprise the antigen binding site of a murine monoclonal antibody and a variable region fragment (lacking the antigen-binding site) derived from a human antibody. Procedures for the production of chimeric and further engineered monoclonal antibodies include those described in (Riechmann et al.,Nature 332:323 (1988), Liu et al., PNAS84:3439 (1987), Larrick et al., Bio/Technology 7:934 (1989), and Winter and Harris, TIPS 14:139 (May 1993)). Procedures to generate antibodies transgenically can be found in GB 2,272,440, U.S. Pat. Nos. 5,569,825 and 5,545,806 and related patents claiming priority therefrom, all of which are incorporated by reference herein.
- Antigen-binding fragments of the antibodies, which may be produced by conventional techniques, are also encompassed by the present invention. Examples of such fragments include, but are not limited to, Fab and F(ab′)2 fragments. Antibody fragments and derivatives produced by genetic engineering techniques are also provided.
- In one embodiment, the antibodies are specific for the polypeptides of the present invention and do not cross-react with other proteins. Screening procedures by which such antibodies may, be identified are well known, and may involve immunoaffinity chromatography, for example.
- The following examples further illustrate preferred aspects of the invention.
- Cell Culture and Androgen Stimulation
- LNCaP cells (American Type Culture Collection, Rockville, Md.) were used for SAGE analysis of ARGs. LNCaP cells were maintained in RPMI 1640 (Life Technologies, Inc., Gaithersburg, Md.) supplemented with 10% fetal bovine serum (FBS, Life Technologies, Inc., Gaithersburg, Md.) and experiments were performed on cells between passages 20 and 30. For the studies of androgen regulation, charcoal/dextran stripped androgen-free FBS (cFBS, Gemini Bio-Products, Inc., Calabasas, Calif.) was used. LNCaP cells were cultured first in RPMI 1640 with 10% cFBS for 5 days and then stimulated with 10-8 M of non-metabolizable androgen analog, R1881 (DUPONT, Boston, Mass.) for 24 hours. LNCAP cells identically treated but without R1881 treatment served as control. Cells were harvested at indicated time and polyA− RNA was double-selected with Fast Track kit (Invitrogene). The quality of polyA+ was checked by Northern hybridization analysis.
- SAGE Analysis
- Two SAGE libraries (library LNCaP-C and library LNCaP-T) were generated according to the procedure described previously Velculescu et al. (30). Briefly, biotinylated oligo dT primed cDNA was prepared from five micrograms of polyA+ RNA from R1881 treated and control LNCaP cells and biotinylated cDNA was captured on strepravidin coated magnetic beads (Dynal Corporation, MI). cDNA bound to the magnetic beads were digested by NlaIII followed by ligation to synthetic linkers containing a site for anchoring enzyme, NlaIII and a site for tagging enzyme BsrhF1. The restriction digestion of ligated products with BsmF1 resulted in the capture of 10-11 bp sequences termed as “tags” representing signature sequence of unique cDNAs. A multi-step strategy combining ligation, PCR, enzymatic digestion and gel purification yielded two tags linked together termed as “ditags.” Ditags were concatamerized, purified and cloned in plasmid pZero cloning vector (Invitrogen, CA). The clones containing concatamers were screened by PCR and sequenced. The sequence and the occurrence of each of the SAGE tags was determined using the SAGE software kindly provided by Dr. Kenneth W. Kinzler (Johns Hopkins University School of Medicine, Baltimore, Md.). All the SAGE tags sequences were analyzed for identity to DNA sequence in GenBank (National Center for Biotechnology Information, Bethesda, Md., USA). The relative abundance of each transcript was determined by dividing the number of individual tags by total tags in the library. The copy number of each gene was calculated assuming there are approximately 300,000 transcripts in a cell (Zhang et al., 1997). The differentially expressed SAGE tags were determined by comparing the frequency of occurrence of individual tags in the two libraries obtained from the control (library LNCaP-C) and R1881 treated LNCaP cells (library LNCaP-T). The results were analyzed with t test, and p<0.05 was considered as a statistically significant difference for a specific tag between these two libraries.
- Kinetics of Androgen Regulation ARGs Defined by SAGE Analysis
- LNCaP cells were cultured in RPMI 1640 with 10% cFBS for 5 days, then stimulated with R1881 at 10-10, 10-8, and 10-6 M for 1, 3, 12, 24, 72, 120, 168, and 216 hours. LNCaP cells identically treated but without R1881 served as control. The cells were harvested at indicated time and polyA+ RNA was prepared as described as above. The polyA+ RNA was fractionated (2 μg/lane) by running through 1% formmaldehyde-agarose gel and transferred to nylon membrane. The cDNA probes of several ARGs were labeled with32P-dCTP by random priming (Stratagene Cloning Systems, La Jolla, Calif.). The nylon membranes were prehybridized for 2 hrs in hybridization buffer (10 mM Tris-HCl, pH 7.5, 10% Dextran sulfate, 40% Formamide, 5×SSC, 5× Denhardt's solution and 0.25 mg/ml salmon sperm DNA) and hybridized to the 32P labeled probes (1×106 cpm/ml) in the same buffer at 40° C. for 12-16 hrs. Blots were washed twice in 2×SSC/0.1% SDS for 20 min at room temperature followed by two high-stringency wash with 0.1×SSC/0.1% SDS at 50° C. for 20 min. Nylon membranes were exposed to X-ray film for autoradiography.
- ARGs Expression Pattern in Cwr22 Model.
- CWR22 (androgen dependent) and CWR22R (androgen relapsed) tumor specimens were kindly provided by Dr. Thomas Pretlow (Case Western Reserve University School of Medicine). The tissue samples were homogenized and polyA+ RNA was extracted with Fast Track kit (Invitrogen) following manufacture's protocol. Northern blots were prepared as described in Example 3 and were hybridized with32P labeled probes of the cDNA of interest.
- Analysis of SAGE tag libraries from R1881 treated LNCaP cells. LNCaP cells were maintained in androgen deprived growth media for five days and were treated with synthetic androgen R1881 (10 nm) for 24 hours. Since a goal of the inventors was to identify androgen signaling read-out transcripts, we chose conditions of R1881 treatment of LNCaP cells showing a robust and stable transcriptional induction of well-characterized prostate-specific androgen regulated genes, prostate-specific antigen (PSA) and NKX3.1 genes. A total of 90,236 tags were derived from the two SAGE libraries. Of 90,236 tags, 6,757 tags corresponded to linker sequences, and were excluded from further analysis. The remaining 83,489 tags represented a total of 23,448 known genes or ESTs and 1,655 tags did not show any match in the GeneBank data base. The relative abundance of the SAGE tags varied between 0.0011% and 1.7%. Assuming that there are 18,000 transcripts per cell type and there are about 83,489 anticipated total transcripts, the estimated abundance of transcripts will be 0.2-308 copies per cell. This calculation indicated that single copy genes had high chance to be recognized by SAGE analysis in this study. The distribution of transcripts by copy number suggests that the majority (above 90%) of the genes in our analysis are expressed at 1 or 2 copies level/cell. A total of 46,186 and 45,309 tags were analyzed in the control (C) and R1881 (T) groups respectively. Unique SAGE tags corresponding to known genes, expressed sequence tags (ESTs) and novel transcripts were 15,593 and 15,920 in the control and androgen treated groups respectively. About 94% of the unique SAGE tags in each group showed a match to a sequence in the gene bank and 6% SAGE tags represented novel transcripts. The most abundant SAGE tags in both control and androgen treated LNCaP cells represented proteins involved in cellular translation machinery e.g., ribosomal proteins, translation regulators, mitochondrial proteins involved in bio-energetic pathways.
- Analysis of the ARGs Defined by SAGE Tags
- Of about 15,000 unique tags a total of 136 SAGE tags were significantly up-regulated in response to R1881 whereas 215 SAGE tags were significantly down-regulated (p<0.05). It is important to note that of 15,000 expressed sequences only 1.5% were androgen responsive suggesting that expression of only a small subset of genes are regulated by androgen under our experimental conditions. The ARGs identified by the inventors are anticipated to represent a hierarchy, where a fraction of ARGs are directly regulated by androgens and others represent the consequence of the activation of direct down-stream target genes of the AR. Comparison of SAGE tags between control and R1881 also revealed that 74 SAGE tags were significantly up-regulated (p<0.05) by four-fold and 120 SAGE tags were significantly (p<0.05) down-regulated. Two SAGE tags corresponding to the PSA gene sequence exhibited highest induction (16 fold) between androgen treated (T) and control (C) groups. Another prostate specific androgen regulated gene, NKX3.1 was among significantly up-regulated ARGs (8 fold). Prostate specific membrane antigen (PSMA) and Clusterin known to be down-regulated by androgens were among the SAGE tags exhibiting decreased expression in response to androgen (PSMA, 4 fold; Clusterin, fold). Therefore, identification of well characterized up-regulated and down-regulated ARGs defined by SAGE tags validates the use of LNCaP experimental model for defining physiologically relevant ARGs in the context of prostatic epithelial cells. It is important to note that about 90% of up-regulated ARGs and 98% of the down-regulated ARGs defined by our SAGE analysis were not known to be androgen-regulated before.
- Identification of Prostate Specific/Abundant Genes
- LNCaP C/T-SAGE tag libraries were compared to a bank of 35 SAGE tag libraries (http://www.ncbi.nlm.nih.gov/SAGE/) containing 1.5 million tags from diverse tissues and cell types. Our analysis revealed that known prostate specific genes e.g., PSA and NKX3.1 were found only in LNCaP SAGE tag libraries (this report and one LNCaP SAGE library present in the SAGE tag bank). We have extended this observation to the other candidate genes and transcripts. On the basis of abundant/unique expression of the SAGE tag defined transcripts in LNCaP SAGE tag libraries relative to other libraries, we have now identified several candidate genes and ESTs whose expression are potentially prostate specific or restricted (Table 4). The utility of such prostate-specific genes includes: (a) the diagnosis and prognosis of CaP (b) tissue specific targeting of therapeutic genes (c) candidates for immunotherapy and (d) defining prostate specific biologic functions.
- Genes with defined functions showing at least five fold up or down-regulation (p<0.05) were broadly classified on the basis of their biochemical function, since our results of Northern analysis of representative SAGE derived ARGs at 5-fold difference showed most reproducible results. Table 9, presented at the end of this specification immediately preceding the “References” section, represents the quantitative expression profiles of a panel of functionally defined ARGs in the context of LNCaP prostate cancer cells. ARGs in the transcription factor category include proteins involved in the general transcription machinery e.g., KAPl/TIF β, CHD4 and SMRT (Douarin et al., 1998; Xu et al., 1999) have been shown to participate in transcriptional repression. The mitochondrial transcription factor 1 (mtTF1) was induced by 8 fold in response to R1881. A recent report describes that another member of the nuclear receptor superfamily, the thyroid hormone receptor, also up-regulates a mitochondrial transcription factor expression through a specific co-activator, PGC-1 (Wu et al., 1999). As shown in Table 9 a thyroid hormone receptor related gene, ear-2 (Miyajima et al., 1998) was also upregulated by R188. It is striking to note that expression of four [NKX3.1 (He et al., 1997). HOX B13 (Sreenath et al., 1999), mtTF1 and PDEF (Oettgen et al., 2000)] of the eight transcription regulators listed in Table 9 appear to be prostate tissue abundant/specific based on published reports as well as our analysis described above.
- ARGs also include a number of proteins involved in cellular energy metabolism and it is possible that some of these enzymes may be transcriptionally regulated by mtTF1. Components of enzymes involved in oxidative decaboxylation: dihydrolipoamide succinyl transferase (Patel et al., 1995), puruvate dehydrogenase E-1 subunit (Ho et al., 1989), and the electron tansport chain:
NADH dehydrogenase 1 beta subcomplex 10 (Ton et al., 1997) were upregulated by androgen. VDAC-2 (Blachly-Dyson et al., 1994), a member of small pore forming proteins of the outer mitochondrial membrane and which may regulate the transport of small metabolites necessary for oxidative-phosphorylation, was also up regulated by androgen. Diazepam binding protein (DBI), a previous reported ARG (Swinnen et al., 1996), known to be associated with the VDAC complex and implicated in a multitude of functions including modulation of pheripheral benzodiaepine receptor, acyl-CoA metabolism and mitochondrial steroidogenesis (Knudsen et al., 1993) were also induced by androgen in our study. A thioredoxin like protein (Miranda-Vizuete et al., 1998) which may function in modulating the cellular redox state was down regulated by androgen. In general, it appears that modulation of ARGs involved in regulating cellular redox status and energy metabolism may effect reactive oxygen species concentrations. - A number of cell proliferation associated proteins regulating cell cycle, signal transduction and cellular protein trafficking were upregulated by androgen, further supporting the role of androgens in survival and growth of prostatic epithelial cells. Androgen regulation of two proteins: XRCC2 (Cartxvrght et al., 1998) and RPA3 (Umbricht et al., 1993) involved in DNA repair and recombination is a novel and interesting finding. Induction of these genes may represent a response to DNA damage due to androgen mediated pro-oxidant shift, or these genes simply represent components of genomic surveillance mechanisms stimulated by cell proliferation. The androgen induction of a p53 inducible gene, PIG 8 (Umbricht et al., 1997), is another intriguing finding as the mouse homolog of this gene, ei24 (Gu et al., 2000), is induced by etoposide known to generate reactive oxygen species. In addition, components of protein kinases modulated by adenyl cyclase, guanyl cyclase and calmodulin involved in various cellular signal transduction stimuli were also regulated by androgen.
- Gene expression modulations in RNA processing and translation components is consistent with increased protein synthesis expected in cells that are switched to a highly proliferative state. Of note is nucleolin, one of the highly androgen induced genes (12 fold) which is an abundant nucleolar protein associating with cell proliferation and plays a direct role in the biogenesis, processing and transport of ribosomes to the cytoplasm (Srivastava and Pollard, 1999). Another androgen up-regulated gene, exportin, a component of the nuclear pore, may be involved in the shuttling of nucleolin. Androgen regulation of SiahBP 1 (Page-McCaw et al., 1999), GRSF-1 (Qian and Wilusz, 1994) and PAIP1 (Craig et al., 1998) suggests a role of androgen signaling in the processing of newly transcribed RNAs. Two splicesosomal genes, snRNP-G and snRNP-E coding for small ribo-nucleoproteins were down-regulated by androgen. The unr-interacting protein, UNRIP (Hunt et al., 1999) which is involved in the direct ribosome entry of many viral and some cellular mRNAs into the translational pathway, was the most down-regulated gene in response to androgen.
- Quantitative evaluation of gene expression profiles by SAGE approach have defined yeast transcriptome (Velculescu et al., 1997) and have identified critical genes in biochemical pathways regulated by p53 (Polyak et al., 1997), x-irradiation (Hermeking et al., 1997) and the APC gene (Korinek et al., 1997). Potential tumor biomarkers in colon (Zhang et al., 1997), lung (Hibi et al., 1998), and breast (Nacht et al., 1999) cancers and genes regulated by other cellular stimuli (Waard et al., 1999; Berg et al., 1999) have also been identified by SAGE. SAGE technology has enabled us to develop the first quantitative database of androgen regulated transcripts. Comparison of our SAGE tag libraries to the SAGE TagBank has also revealed a number of new candidate genes and ESTs whose expression is potentially abundant or specific to the prostate. We have also identified a large number of transcripts not previously defined as ARGs.
- A great majority of functionally defined genes that were modulated by androgen in our experimental system appear to promote cell proliferation, cell survival, gain of energy and increased oxidative reactions shift in the cells. However, a substantial fraction of these ARGs appears to be androgen specific since they do not exhibit appreciable change in their expression in other studies examining cell proliferation associated genes (Iyer et al., 1999, genome-www.stanford.edu/serum) or estrogen regulated genes in MCF7 cells (Charpentier et al., 2000). The interesting experimental observation of Ripple et al. (Ripple et al., 1997) showing a prooxidant-antioxidant shift induced by androgen in prostate cancer cells is supported by our identification of specific ARGs (upregulation of enzymes involved in oxidative reactions, electron transport chain and lipid metabolism in mitochondria and down regulation of thioredoxin like protein) that may be involved in the induction of oxidative stress by androgen.
- Characterization of the Androgen-Regulated Gene PMEPA1
- cDNA library screening and Sequencing of cDNA clone. One of the SAGE tags (14 bp) showing the highest induction by androgen (29-fold) exhibited homology to an EST in the GenBank EST database. PCR primers (5′GGCAGAACACTCCGCGCTTCTTAG3′ (SEQ ID NO. 5) and 5′CAAGCTCTCTTAGCTTGTGCATTC3′ (SEQ ID NO. 6)) were designed based on the EST sequence (accession number AA310984). RT-PCR was performed using RNA from R1881 treated LNCaP cells and the co-identity of the PCR product to the EST was confirmed by DNA sequencing. Using the PCR product as probe, the normal prostate cDNA library was screened through the service provided by Genome Systems (St. Louis, Mo.). An isolated clone, GS 22381 was sequenced using the 310 Genetic Analyzer (PE Applied Biosystems, Foster Calif.) and 750 bp of DNA sequence was defined, which included 2/3 of the coding region of PMEPA1. A GenBank search with PMEPA1 cDNA sequence revealed one EST clone (accession number AA088767) homologous to the 5′ region of the PMEPA1 sequence. PCR primers were designed using the EST clone (5′ primer) and PMEPA1 (3′ primer) sequence. cDNA from LNCaP cells was PCR amplified and the PCR product was sequenced using the PCR primers. The sequences were verified using at least two different primers. A contiguous sequence of 1,141 bp was generated by these methods.
- Kinetics of androgen regulation of PMEPA1 expression in LNCaP cells. LNCaP cells (American Type Culture Collection, ATCC, Rockville Md.) were maintained in RPMI 1640 media (Life Technologies, Inc., Gaithersburg, Md.) supplemented with 10% fetal bovine serum (FBS, Life Technologies, Inc., Gaithersburg, Md.) and experiments were performed on cells cultured between passages 20 and 30. For the studies of androgen regulation, charcoal/dextran stripped androgen-free FBS (cFBS, Gemini Bio-Products, Inc., Calabasas, Calif.) was used. LNCaP cells were cultured first in RPMI 1640 with 10% cFBS for 5 days, and then stimulated with R1881 (DUPONT, Boston, Mass.) at 10-10 M and 108 M for 3, 6, 12 and 24 hours. LNCaP cells identically treated but without R1881 served as control. To study the effects of androgen withdrawal on PMEPA1 gene expression, LNCaP cells were cultured in RPMI 1640 with 10% cFBS for 24, 72 and 96 hours. Poly A+ RNA samples derived from cells treated with or without R18881 were extracted at indicated time points with a Fast Track mRNA extraction kit (Invitrogen, Carlsbad, Calif.) following the manufacturer's protocol. Poly A+ RNA specimens (2 μg/lane) were electrophoresed in a 1% formaldehyde-agarose gel and transferred to a nylon membrane. Two PMEPA1 probes used for Northern blots analysis were (a) cDNA probe spanning nucleotides 3-437 of PMEPA1 cDNA sequence (See Table 1) and (b) 71-mer oligonucleotide between nucleotides 971 to 1,041 of PMEPA1 cDNA sequence (See Table 1).
- The cDNA probe was generated by RT-PCR with
primers 5′CTTGGGTTCGGGTGAAAGCGCC 3′ (SEQ ID NO. 7) (sense) and 5′GGTGGGTGGCAGGTCGATCTCG 3′ (SEQ ID NO. 8) (antisense). PMEPA1 oligonucleotide and cDNA probes and glyceraldehyde phosphate dehydrogenase gene (GAPDH) cDNA probe were labeled with 32P-dCTP using 3′ end tailing for oligonucleotides (Promega, Madison, Wis.) and random priming for cDNA (Stratagene, La Jolla, Calif.). The nylon membranes were treated with hybridization buffer (10 mM Tris-HCl, pH 7.5, 10% Dextran sulfate, 40% Formamide, 5×SSC, 5× Denhardt's solution and 0.25 mg/ml salmon sperm DNA) for two hours followed by hybridization in the same buffer containing the 32P labeled probes (1×106 cpm/ml) for 12-16 hrs at 40° C. Blots were washed twice in 2×SSC/0.1% SDS for 20 min at room temperature followed by two high-stringency washes with 0.1×SSC/0.1% SDS at 58° C. for 20 min. Nylon membranes were exposed to X-ray film for autoradiography. The bands on films were then quantified with N1H-Image processing software. - PMEPA1 expression analysis in CWR22 tumors. CWR22 is an androgen-dependent, serially transplantable nude mouse xenograft derived from a primary human prostate cancer. Transplanted CWR22 tumors are positive for AR and the growth of CWR22 is androgen dependent. CWR22 tumors regress initially upon castration followed by a relapse. The recurrent CWR22 tumors (CWR22R) express AR, but the growth of these tumors become androgen-independent (Gregory et al., 1998; Nagabhushan et al., 1996). One
CW 2 and four CWR22R tumor specimens were kindly provided by Dr. Thomas Pretlow's laboratory (Case Western Reserve University School of Medicine). Tumor tissues were homogenized and poly A+ RNA were extracted as above. Poly A+ RNA blots were made and hybridized as described above. - PMEPA1 expression analysis in multiple human tissues and cell lines. Multiple Tissue Northern blots containing mRNA samples from 23 human tissues and Master Dot blots containing mRNA samples from 50 different human tissues were purchased from ClonTech (Palo Alto, Calif.). The blots were hybridized with PMEPA1 cDNA and oligo probes, as described above. The expression of PMEPA1 in normal prostate epithelial cells (Clonetics, San Diego, Calif.), prostate cancer cells PC3 (ATCC) and LNCaP cells and breast cancer cells MCF7 (ATCC) was also analyzed by northern blot.
- In situ hybridization of PMEPA1 in prostate tissues. A 430 bp PCR fragment (PCR sense primer: 5′
CCTTCGCCCAGCGGGAGCGC 3′, (SEQ ID NO. 9)PCR antisense primer 5′CAAGCTCTCTTAGCTTGTGCATTC3′ (SEQ ID NO. 10) was amplified from cDNA of LNCaP cells treated by R1881 and was cloned into a PCR-blunt II-TOPO vector (Invitrogen, Carlsbad, Calif.). Digoxigenin labeled antisense and sense riboprobes were synthesized using an in vitro RNA transcription kit (Boehringer Mannheim, GMbH, Germany) and a linearized plasmid with PMEPA1 gene fragment as templates. Frozen normal and malignant prostate tissues were fixed in 4% paraformaldehyde for 30 min. Prehybridization and hybridization were performed at 55° C. After hybridization, slides were sequentially washed with 2×SSC at room temperature for 30 min, 2×SSC at 58° C. for 1 hr and 0.1×SSC at 58° C. for 1 hr. Antibody against digoxygenin was used to detect the signal and NBT/BCIP was used as substrate for color development (Boehringer Mannheim, GMbH, Germany). The slides were evaluated under an Olympus BX-60 microscope. - Full-Length PMEPA1 Coding Sequence and Chromosomal Localization
- Analysis of the 1,141 bp PMEPA1 cDNA sequence (SEQ ID NO. 1) revealed an open reading frame of 759 bp nucleotides (SEQ ID NO. 2) encoding a 252 amino acid protein (SEQ ID NO. 3) with a predicted molecular mass of 27.8 kDa, as set forth below in Table 1.
TABLE 1 (SEQ ID NO. 3) TCCTTGGGTTCGGGTGAAAGCGCCTGGGGGTTCGTGGCCATGATCCCCGAGCTGCTGGAGAACTGAAGGCGGACAGTCTCCTGCGAAAC 90 ▾ AGGCAATGGCGGAGCTGGAGTTTGTTCAGATCATCATCATCGTGGTGGTGATGATGGTGATGGTGGTGGTGATCACGTGCCTGCTGAGCC 180 M A E L E F V Q I I I I V V V M M V M V V V I T C L L S 28 ▾ ACTACAAGCTGTCTGCACGGTCCTTCATCAGCCGGCACAGCCAGGGGCGGAGGAGAGAAGATGCCCTGTCCTCAGAAGGATGCCTGTGGC 270 H Y K L S A R S F I S R H S Q G R R R E D A L S S E G C L W 58 ▾ CCTCGGAGAGCACAGTGTCAGGCAACGGAATCCCAGAGCCGCAGGTCTACGCCCCGCCTCGGCCCACCGACCGCCTGGCCGTGCCGCCCT 360 P S E S T V S G N G I P E P Q V Y A P P R P T D R L A V P P 88 TCGCCCAGCGGGAGCGCTTCCACCGCTTCCAGCCCACCTATCCGTACCTGCAGCACGAGATCGACCTGCCACCCACCATCTCGCTGTCAG 450 F A Q R E R F H R F Q P T Y P Y L Q H E I D L P P T I S L S 118 ACGGGGAGGAGCCCCCACCCTACCAGGGCCCCTGCACCCTCCAGCTTCGGGACCCCGAGCAGCAGCTGGAACTGAACCGGGAGTCGGTGC 540 D G E E P P P Y Q G P C T L Q L R D P E Q Q L E L N R E S V 148 GCGCACCCCCAAACAGAACCATCTTCGACAGTGACCTGATGGATAGTGCCAGGCTGGGCGGCCCCTGCCCCCCCAGCAGTAACTCGGGCA 630 R A P P N R T I F D S D L M D S A R L G G P C P P S S N S G 178 TCAGCGCCACGTGCTACGGCAGCGGCGGGCGCATGGAGGGGCCGCCGCCCACCTACAGCGAGGTCATCGGCCACTACCCGGGGTCCTCCT 720 I S A T C Y G S G G R M E G P P P T Y S E V I G H Y P G S S 208 TCCAGCACCAGCAGAGCAGTGGGCCGCCCTCCTTGCTGGAGGGGACCCGGCTCCACCACACACACATCGCGCCCCTAGAGAGCGCAGCCA 810 F Q H Q Q S S G P P S L L E G T R L H H T H I A P L E S A A 238 TCTGGAGCAAAGAGAAGGATAAACAGAAAGGACACCCTCTCTAGGGTCCCCAGGGGGGCCGGGCTGGGGCTGCGTAGGTGAAAAGGCAGA 900 I W S K E K D K Q K G H P L * 252 (SEQ ID NO. 1) ACACTCCGCGCTTCTTAGAAGAGGAGTGAGAGGAAGGCGGGGGGCGCAGCAACGCATCGTGTGGCCCTCCCCTCCCACCTCCCTGTGTAT 990 AAATATTTACATGTGATGTCTGGTCTGAATGCACAAGCTAAGAGAGCTTGCAAAAAAAAAAAGAAAAAAGAAAAAAAAAAACCACGTTTC 1080 ▾ TTTGTTGAGCTGTGTCTTGAAGGCAAAAGAAAAAAAATTTCTACAGTAAAAAAAAAAAAAA 1141 - As indicated above, Table 1 represents the nucleotide and predicted amino acid sequence of PMEPA1 (GenBank accession No. AF224278). The potential initiation methionine codon and the translation stop codons are indicated in bold. The transmembrane domain is underlined. The locations of the intron/exon boundaries are shown with arrows, which were determined by comparison of the PMEPA1 cDNA sequence to the publicly available sequences of human clones RP5-1059L7 and 718J7 (GenBank accession No. AL121913 and AL035541).
- A GenBank search revealed a sequence match of PMEPA1 cDNA to two genomic clones, RP5-1059L7 (accession number AL121913 in the GenBank/htgc database) and 718J7 (accession number AL035541 in the GenBank/nr database). These two clones mapped to Chromosome 20q13.2-13.33 and Chromosome 20q13.31-13.33. This information provided evidence that PMEPA1 is located on chromosome 20q13.
- The intron/exon juctions of PMEPA1 gene were determined based on the comparison of the sequences of PMEPA1 and the two genomic clones. A protein motif search using ProfileScan (http://www.ch.embnet.org/cgi-bin/TMPRED) indicated the existence of a type Ib transmembrane domain between amino acid residues 9 to 25 of the PMEPA1 sequence. Another GenBank search further revealed that the PMEPA1 showed homology (67% sequence identity and 70% positives at protein level) to a recently described novel cDNA located on chromosome 18 (accession number NM—004338) (Yoshikawa et al., 1998), as set forth below in Table 2. In addition to the sequence similarity, PMEPA1 also shares other features with C18orf1, e.g., similar size of the predicted protein and similar transmembrane domain as the β1 isoform of C18orf1.
TABLE 2 2 AELEFVQIIIIVVVMMVMVVVITCLLSHYKLSARSFISRHSQGRRREDALSSEGCLWPSE 61 PMEPA1 (SEQ ID NO: 11) AELEF QIIIIVVV V VVVITCLL+HYK+S RSFI+R +Q RRRED L GCLWPS+ 3 AELEFAQIIIIVVVVTVMVVVIVCLLNHYKVSTRSFINRPNQSRRREDGLPQEGCLWPSD 62 C18orf1 (SEQ ID NO: 12) 62 STVSGNGIPEPQVYAPPRPTDRLAVPPFAQRERFHRFQPTYPYLQHEIDLPPTISLSDGE 121 PMEPA1 S G E + PR DR P F QR+RF RFQPTYPY+QHEIDLPPTISLSDGE 63 SAAPRLGASE--IMHAPRSRDRFTAPSFIQRDRFSRFQPTYPYVQHEIDLPPTISLSDGE 120 C18orf1 122 EPPPYQGPCTLQLRDPEQQLELNRESVRAPPNRTIFDSDLMDSARL-GGPCPPSSNSGIS 180 PMEPA1 EPPPYQGPCTLQLRDPEQQ+ELNRESVRAPPNRTIFDSDL+D A GGPCPPSSNSGIS 121 EPPPYQGPCTLQLRDPEQQMELNRESVRAPPNRTIFDSDLIDIAMYSGGPCPPSSNSGIS 180 C18orf1 181 ATCYGSGGRMEGPPPTYSEVIGHYPGSSFQHQQSSGPPSLLEGTRLHHTHIAPLESAAIW 240 PMEPA1 A+ S GRMEGPPPTYSEV+GH+PG+SF H Q S + G+RL ES + 181 ASTCSSNGRMEGPPPTYSEVMGHHPGASFLHHQRS---NAHRGSRLQFQQ-NNAESTIVP 236 C18orf1 241 SKEKDKQKGH 250 PMEPA1 K KD++ G+ 237 IKGKDRKPGN 246 C18orf1 - Analysis of PMEPA1 Expression
- Northern hybridization revealed two transcripts of ˜2.7 kb and ˜5 kb using either PMEPA1 cDNA or oligo probe. The signal intensity of bands representing these two transcripts was very similar on the X-ray films of the northern blots. RT-PCR analysis of RNA from LNCaP cells with four pairs of primers covering different regions of PMEPA1 protein coding region revealed expected size of bands from PCR reactions, suggesting that two mRNA species on northern blot have identical sequences in the protein coding region and may exhibit differences in 5′ and/or 3′non-coding regions. However, the exact relationship between the two bands remains to be established. Analysis of multiple northern blots containing 23 human normal tissues revealed the highest level of PMEPA1 expression in prostate tissue. Although other tissues expressed PMEPA1, their relative expression was significantly lower as compared to prostate (FIG. 1). In situ RNA hybridization analysis of PMEPA1 expression in prostate tissues revealed abundant expression in the glandular epithelial compartment as compared to the stromal cells. However, both normal and tumor cells in tissue sections of primary tumor tissues revealed similar levels of expression.
- Androgen Dependent Expression of PMEPA1
- As discussed above, PMEPA1 was originally identified as a SAGE tag showing the highest fold induction (29-fold) by androgen. Androgen depletion of LNCaP cells resulted in decreased expression of PMEPA1. Androgen supplementation of the LNCaP cell culture media lacking androgen caused induction of both ˜2.7 and ˜5.0 bp RNA species of PMEPA1 in LNCaP cells in a dose and time dependent fashion (FIG. 2A). Basal level of PMEPA1 expression was detected in normal prostatic epithelial cell cultures and androgen-dependent LNCaP cells cultured in regular medium. PMEPA1 expression was not detected in AR negative CaP cells. PC3 or in the breast cancer cell line, MCF7 (FIG. 2B).
- Evaluation of PMEPA1 Expression in Androgen Sensitive and Androgen Refractory Tumors of CWR 22 Prostate Cancer Xenograft Model
- Previous studies have described increased expression of ARGs in the “hormone refractory” CWR22R variants of the CWR22 xenograft, suggesting the activation of AR mediated cell signaling in relapsed CWR22 tumors following castration. The androgen sensitive CWR2 tumor expressed detectable level of PMEPA1 transcripts. However, three of the four CWR22R tumors exhibited increased PMEPA1 expression (FIG. 3).
- The specification is most thoroughly understood in light of the teachings of the references cited within the specification which are hereby incorporated by reference. The embodiments within the specification provide an illustration of embodiments of the invention and should not be construed to limit the scope of the invention. The skilled artisan readily recognizes that many other embodiments are encompassed by the invention.
TABLE 3 Genes Regulated by Androgen: SAGE Data Derived from CPDR SAGE Library Accession Description Effect of Androgen AA310984 EST Up-regulated by Androgen M26663 Homo sapiens prostate-specific antigen mRNA, Up-regulated by Androgen complete cds.* AA508573 Human nucleolin gene, complete cds Up-regulated by Androgen AB020637 Homo sapiens mRNA for KIAA0830 protein, partial Up-regulated by Androgen cds. AA280663 EST Up-regulated by Androgen U31657 KRAB-associated protein 1Up-regulated by Androgen AI879709 EST Up-regulated by Androgen AA602190 EST Up-regulated by Androgen AF035587 Homo sapiens X-ray repair cross-complementing Up-regulated by Androgen protein 2 (XRCC2) AF151898 Homo sapiens CGI-140 protein mRNA Up-regulated by Androgen AA418786 No reliable matches, only see in two linberary (1 Up-regulated by Androgen each) AI308812 EST Up-regulated by Androgen X59408 Membrane cofactor protein (CD46, trophoblast- Up-regulated by Androgen lymphocyte cross-reactive antigen) X81817 Accessory proteins BAP31/BAP29 Up-regulated by Androgen AF071538 Homo sapiens Ets transcription factor PDEF Up-regulated by Androgen (PDEF) mRNA, complete NM_003201 Transcription factor 6-like 1 (mitochondrial Up-regulated by Androgen transcription factor 1-like) U41387 Human Gu protein mRNA, partial cds. Up-regulated by Androgen U58855 Guanylate cyclase 1, soluble, alpha 3Up-regulated by Androgen X12794 Human v-erbA related ear-2 gene. Up-regulated by Androgen U88542 Mus musculus homeobox protein Nkx3.1 Up-regulated by Androgen D89729 Homo sapiens mRNA for CRM1 protein, complete Up-regulated by Androgen cds. U75329 TMPRSS2 Up-regulated by Androgen AA062976 EST Up-regulated by Androgen L12168 Homo sapiens adenylyl cyclase-associated protein Up-regulated by Androgen (CAP) mRNA AA043945 EST Up-regulated by Androgen AF026291 Homo sapiens chaperonin containing t-complex Up-regulated by Androgen polypeptide 1, delta AB002301 Human mRNA for KIAA0303 gene, partial cds. Up-regulated by Androgen D13643 Human mRNA for KIAA0018 gene, complete cds. Up-regulated by Androgen AI310341 EST Up-regulated by Androgen U49436 Human translation initiation factor 5 (eIF5) mRNA, Up-regulated by Androgen complete cds S79862 Proteasome (prosome, macropain) 26S subunit, non- Up-regulated by Androgen ATPase, 5 M14200 Human diazepam binding inhibitor (DBI) mRNA, Up-regulated by Androgen complete cds. AA653318 FK506-binding protein 5Up-regulated by Androgen L07493 Homo sapiens replication protein A 14kDa subunit Up-regulated by Androgen (RPA) mRNA, AJ011916 Homo sapiens mRNA for hypothetical protein. Up-regulated by Androgen AA130537 EST Up-regulated by Androgen D16373 Human mRNA for dihydrolipoamide Up-regulated by Androgen succinyltransferase, complete cds. AL096857 Novel human mRNA from chromosome 1Up-regulated by Androgen AF007157 Homo sapiens clone 23856 unknown mRNA, partial Up-regulated by Androgen cds. AA425929 NADH dehydrogenase (ubiquinone) 1 beta Up-regulated by Androgen subcomplex, 10 (22kD, PDSW) AI357815 EST Up-regulated by Androgen D83778 Human mRNA for KIAA0194 gene, partial cds. Up-regulated by Androgen AF000979 Homo sapiens testis-specific Basic Protein Y 1Up-regulated by Androgen (BPY1) mRNA, AA889510 EST Up-regulated by Androgen AB018330 Homo sapiens mRNA for KIAA0787 protein, partial Up-regulated by Androgen cds. AA026941 EST Up-regulated by Androgen AA532377 Chromosome 1 open reading frame 8 Up-regulated by Androgen AF010313 Homo sapiens Pig8 (PIG8) mRNA (etoposide- Up-regulated by Androgen induced mRNA), complete cds. L06328 Human voltage-dependent anion channel isoform 2Up-regulated by Androgen (VDAC) mRNA, U41804 Human putative T1/ST2 receptor binding protein Up-regulated by Androgen precursor mRNA, AB020676 Homo sapiens mRNA for KIAA0869 protein, partial Up-regulated by Androgen cds. J03503 Human pyruvate dehydrogenase E1-alpha subunit Up-regulated by Androgen mRNA, cds. AA421098 EST Up-regulated by Androgen AF072836 Sox-like transcriptional factor Up-regulated by Androgen AA115355 EST Up-regulated by Androgen AF118240 Homo sapiens, peroxisomal biogenesis factor 16 Up-regulated by Androgen (PEX16) mRNA, complete AA011178 EST Up-regulated by Androgen X15573 Human liver-type 1-phosphofructokinase (PFKL) Up-regulated by Androgen mRNA, complete cds. AA120930 EST Up-regulated by Androgen AB002321 Human mRNA for KIAA0323 gene, partial cds Up-regulated by Androgen AF151837 Homo sapiens CGI-79 protein mRNA, complete cds Up-regulated by Androgen AA481027 EST Up-regulated by Androgen AA039343 EST Up-regulated by Androgen U09716 Human mannose-specific lectin (MR60) mRNA, Up-regulated by Androgen complete cds. AF044773 Homo sapiens breakpoint cluster region protein 1Up-regulated by Androgen (BCRG1) mRNA U51586 Human siah binding protein 1 (SiahBP1) mRNA, Up-regulated by Androgen partial cds. M36341 Human ADP-ribosylation factor 4 (ARF4) mRNA, Up-regulated by Androgen complete cds. AI282096 EST Up-regulated by Androgen W45510 RAB7, member RAS oncogene family-like 1 Up-regulated by Androgen X16135 Human mRNA for novel heterogeneous nuclear RNP Up-regulated by Androgen protein, L protein AF052134 Homo sapiens clone 23585 mRNA sequence, Up-regulated by Androgen AF052134 D26068 Williams-Beuren syndrome chromosome region 1Up-regulated by Androgen X69433 H.sapiens mRNA for mitochondrial isocitrate Up-regulated by Androgen dehydrogenase (NADP+). X61123 B- cell translocation gene 1, anti-proliferativeUp-regulated by Androgen X63423 H.sapiens mRNA for delta-subunit of mitochondrial Up-regulated by Androgen F1F0 ATP-synthase AJ010025 Homo sapiens mRNA for unr-interacting protein. Down-regulated by Androgen AF003938 Homo sapiens thioredoxin-like protein mRNA, Down-regulated by Androgen complete cds. AB014536 Homo sapiens copine III (CPNE3) mRNA Down-regulated by Androgen AA504468 EST Down-regulated by Androgen NM_001273 Chromodomain helicase DNA binding protein 4 Down-regulated by Androgen AA015746 Homo sapiens mRNA; cDNA DKFZp586H0722 Down-regulated by Androgen (from clone DKFZp586H0722) AA552354 EST Down-regulated by Androgen AA025744 3-prime-phosphoadenosine 5-prime-phosphosulfate Down-regulated by Androgen synthase 2 X71129 H.sapiens mRNA for electron transfer flavoprotein Down-regulated by Androgen beta subunit AA046050 EST Down-regulated by Androgen U57052 Human Hoxb-13 mRNA, complete cds Down-regulated by Androgen AA400137 EST Down-regulated by Androgen AA487586 EST Down-regulated by Androgen J04208 Human inosine-5′-monophosphate dehydrogenase Down-regulated by Androgen (IMP) mRNA M64722 Testosterone-repressed prostate message 2 Down-regulated by Androgen (apolipoprotein J) AI743483 EST Down-regulated by Androgen AA476914 EST Down-regulated by Androgen AA026691 EST Down-regulated by Androgen AI014986 EST Down-regulated by Androgen X85373 Small nuclear ribonucleoprotein polypeptide G Down-regulated by Androgen U07231 G-rich RNA sequence binding factor 1 Down-regulated by Androgen T97753 Glycogen synthase 2 (liver) Down-regulated by Androgen AA234050 EST Down-regulated by Androgen AI015143 EST Down-regulated by Androgen U09196 Human 1.1 kb mRNA upregulated in retinoic acid Down-regulated by Androgen treated HL-60 neutrophilic cells. AA977749 EST Down-regulated by Androgen NM_006451 Polyadenylate binding protein-interacting protein 1Down-regulated by Androgen AI818296 EST Down-regulated by Androgen AI250561 EST Down-regulated by Androgen AA063613 EST Down-regulated by Androgen U59209 Hs.183596: UDP glycosyltransferase 2 family,Down-regulated by Androgen polypeptide B17, U59209 Z11559 Iron-responsive element binding protein 1Down-regulated by Androgen AF052578 Homo sapiens androgen receptor associated protein Down-regulated by Androgen 24 (ARA24) X16312 Human mRNA for phosvitin/casein kinase II beta Down-regulated by Androgen subunit. H17890 PCTAIRE protein kinase 3Down-regulated by Androgen AA192312 EST Down-regulated by Androgen AA043787 EST Down-regulated by Androgen AI052020 EST Down-regulated by Androgen AB014512 Homo sapiens mRNA for KIAA0612 protein Down-regulated by Androgen NM_001328 Homo sapiens C-terminal binding protein 1 (CTBP1) Down-regulated by Androgen mRNA M15919 Human autoimmune antigen small nuclear Down-regulated by Androgen ribonucleoprotein E mRNA. AF151813 Homo sapiens CGI-55 protein mRNA, complete cds Down-regulated by Androgen L41351 Protease, serine, 8 (prostasin) Down-regulated by Androgen AF077046 Homo sapiens ganglioside expression factor 2 (GEF- Down-regulated by Androgen 2) homolog U15008 Small nuclear ribonucleoprotein D2 polypeptide Down-regulated by Androgen (16.5kD), AA938995 N62491 Folate hydrolase (prostate-specific membrane Down-regulated by Androgen antigen) 1 AI569591 EST Down-regulated by Androgen AJ131245 Secretory protein 24 (SEC24). Down-regulated by Androgen U90543 Human butyrophilin (BTF1) mRNA, complete cds. Down-regulated by Androgen Z47087 Transcription elongation factor B (SIII), polypeptide Down-regulated by Androgen 1-like M34539 FK506-binding protein 1A (12kD) Down-regulated by Androgen N43807 yy19a05.r1 Soares melanocyte 2NbHM Homo Down-regulated by Androgen sapiens cDNA clone U03269 Human actin capping protein alpha subunit (CapZ) Down-regulated by Androgen mRNA, complete AI571685 EST Down-regulated by Androgen AA010412 EST Down-regulated by Androgen L40403 Homo sapiens (clone zap3) mRNA, 3′ end of cds. Down-regulated by Androgen NM_006560 CUG triplet repeat, RNA-binding protein 1Down-regulated by Androgen NM_004713 Serologically defined colon cancer antigen 1Down-regulated by Androgen U36188 Clathrin-associated/assembly/adaptor protein, Down-regulated by Androgen medium 1 AB020721 KIAA0914 gene product Down-regulated by Androgen T35365 EST Down-regulated by Androgen AF029789 Homo sapiens GTPase-activating protein (SIPA1) Down-regulated by Androgen mRNA, complete cds. AA427857 EST Down-regulated by Androgen AA910404 EST Down-regulated by Androgen L42379 Quiescin Q6 (bone-derived growth factor) Down-regulated by Androgen AL117641 cDNA DKFZp434L235 Down-regulated by Androgen AI688119 EST Down-regulated by Androgen AA688073 EST Down-regulated by Androgen NM_002945 Replication protein A1 (70kD) Down-regulated by Androgen AI797610 EST Down-regulated by Androgen AF086095 Homo sapiens full length insert cDNA clone Down-regulated by Androgen YZ88A07. AF070666 Homo sapiens tissue-type pituitary Kruppel- Down-regulated by Androgen associated box protein R55128 Proteasome (prosome, macropain) 26S subunit, non- Down-regulated by Androgen ATPase, 2 X75621 Tuberous sclerosis 2 Down-regulated by Androgen AA019070 EST Down-regulated by Androgen AI089867 EST Down-regulated by Androgen NM_001003 Homo sapiens ribosomal protein, large, P1 (RPLP1) Down-regulated by Androgen mRNA L05093 Ribosomal protein L18a Down-regulated by Androgen AA854176 EST Down-regulated by Androgen AI929622 Homo sapiens clone 23675 mRNA sequence Down-regulated by Androgen AI264769 ESTs, Weakly similar to ORF YDL087c Down-regulated by Androgen [S.cerevisiae] L09159 Ras homolog gene family, member A, may be Down-regulated by Androgen androgen regulated? AI143187 EST Down-regulated by Androgen H17900 cDNA DKFZp586H051 (from clone Down-regulated by Androgen DKFZp586H051) NM_005617 Ribosomal protein S14 Down-regulated by Androgen L49506 Cyclin G2 Down-regulated by Androgen AA614448 Regulator of G-protein signalling 5 Down-regulated by Androgen S83390 T3 receptor-associating cofactor-1 Down-regulated by Androgen AA917672 EST Down-regulated by Androgen X52151 Arylsulphatase A Down-regulated by Androgen U09646 Carnitine palmitoyltransferase II Down-regulated by Androgen Z50853 ATP-dependent protease ClpAP (E. coli), proteolytic Down-regulated by Androgen subunit, human AB023208 MLL septin-like fusion Down-regulated by Androgen U92014 Human clone 121711 defective mariner transposon Down-regulated by Androgen Hsmar2 mRNA AA878293 Alpha-1-antichymotrypsin Down-regulated by Androgen AA554191 EST Down-regulated by Androgen M55618 Hexabrachion (tenascin C, cytotactin) Down-regulated by Androgen AA027050 EST Down-regulated by Androgen AF112472 Homo sapiens calcium/calmodulin-dependent protein Down-regulated by Androgen kinase II beta AA583866 EST Down-regulated by Androgen AA115687 EST Down-regulated by Androgen AA043318 EST Down-regulated by Androgen U90329 Poly(rC)-binding protein 2 Down-regulated by Androgen Y00815 Protein tyrosine phosphatase, receptor type, F Down-regulated by Androgen X76013 H.sapiens QRSHs mRNA for glutaminyl-tRNA Down-regulated by Androgen synthetase. X75861 Testis enhanced gene transcript Down-regulated by Androgen AA593078 Homo sapiens PAC clone DJ0167F23 from 7p15 Down-regulated by Androgen J04058 Human electron transfer flavoprotein alpha-subunit Down-regulated by Androgen mRNA AF026292 Homo sapiens chaperonin containing t-complex Down-regulated by Androgen polypeptide 1, eta AF068754 Homo sapiens heat shock factor binding protein 1Down-regulated by Androgen HSBP1 mRNA, NM_000172 Guanine nucleotide binding protein (G protein), Down-regulated by Androgen alpha transducing activity polypeptide 1AI140631 Hs.1915: folate hydrolase (prostate-specific Down-regulated by Androgen membrane antigen) 1 -
TABLE 4 Potential Prostate Specific/Abundant Genes Derived From NCBI and CPDR SAGE Libraries Accession Description M88700 Human dopa decarboxylase (DDC) gene, complete cds. W45526 zc26b04.r1 Soares_senescent_fibroblasts_NbHSF Homo sapiens cDNA, Hs.108981: ficolin (collagen/fibrinogen domain-containing) 1, AF201077 NADH:ubiquinone oxidoreductase MLRQ subunit (NDUFA4) mRNA, complete cds with polyA. D55953 HUM407H12B Clontech human fetal brain polyA + mRNA (#6535) Homo, Hs.118724: histidine triad nucleotide-binding protein, AJ012499, mRNA activated in tumor suppression, clone TSAP19 with polyA AA082804 zn41g02.r1 Stratagene endothelial cell 937223 Homo sapiens cDNA, Hs.110967: ESTs, Weakly similar to KIAA0762 protein [H.sapiens], Hs.5662: guanine nucleotide binding protein (G protein), beta polypeptide 2-like 1 in the sequence no tag X05332 Human mRNA for prostate specific antigen.* AI278854 qo42f01.x1 NCI_CGAP_Lu5 Homo sapiens cDNA clone IMAGE:1911193 3′, NM_004537 nucleosome assembly protein 1-like 1 (NAPIL1), tag is at beginning of the gene. W75950 zd58b02.r1 Soares_fetal_heart_NbHH19W Homo sapiens cDNA clone, AF151840, CGI- 82 protein mRNA, tag is at 3′ end. F02980 HSC1IC062 normalized infant brain cDNA Homo sapiens cDNA clone M99487 Human prostate-specific membrane antigen (PSM) mRNA, complete cds. AL035304 H.sapiens gene from PAC 295C6, similar to rat PO44. AI088979 ou86f03.s1 Soares_NSF_F8_9W_OT_PA_P_S1 Homo sapiens cDNA clone AF186249 Homo sapiens six transmembrane epithelial antigen of prostate (STEAP1) mRNA C15801 C15801 Clontech human aorta polyA + mRNA (#6572) Homo sapiens cDNA L10340 Human elongation factor-1 alpha (ef-1) mRNA, 3′ end. NM_004540 Homo sapiens neural cell adhesion molecule 2 (NCAM2) AA151796 z139c02.r1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone NM_001634 Homo sapiens S-adenosylmethionine decarboxylase 1 (AMD1) NM_005013 Homo sapiens nucleobindin 2 (NUCB2)AL121913 in GenBank htgc database) and 718J7 (Accession number AL035541 AF004828 Homo sapiens rab3-GAP regulatory domain mRNA, complete cds. X60819 X60 H.sapiens DNA for monoamine oxidase type A (14) (partial). AA133972 z138g12.r1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone M69226 Human monoamine oxidase (MAOA) mRNA, complete cds. AA969141 op50c11.s1 Soares_NFL_T_GBC_S1 Homo sapiens cDNA clone AA523652 ni64d09.s1 NCI_CGAP_Pr12 Homo sapiens cDNA clone IMAGE:981617, mRNA AF078749 Homo sapiens organic cation transporter 3 (SLC22A3) AA583544 nf25h10.s1 NCI_CGAP_Pr1 Homo sapiens cDNA clone IMAGE:914851, mRNA AF051894 Homo sapiens 15 kDa selenoprotein mRNA, complete cds. AF165967 Homo sapiens DDP-like protein mRNA X57129 H.sapiens H1.2 gene for histone H1. AA640928 nr28d08.r1 NCI_CGAP_Pr3 Homo sapiens cDNA clone IMAGE:1169295, mRNA U41766 Human metalloprotease/disintegrin/cysteine-rich protein precursor AF023676 Homo sapiens lamin B receptor homolog TM7SF2 (TM7SF2) mRNA, U10691 Human MAGE-6 antigen (MAGE6) gene, complete cds. M22976 Human cytochrome b5 mRNA, 3′ end. L14778 Human calmodulin-dependent protein phosphatase catalytic subunit AF071538 Homo sapiens Ets transcription factor PDEF (PDEF) mRNA, complete U39840 Human hepatocyte nuclear factor-3 alpha (HNF-3 alpha) mRNA, AA532511 nj54d03.s1 NCI_CGAP_Pr9 Homo sapiens cDNA clone IMAGE:996293, mRNA X07166 Human mRNA for enkephalinase (EC 3.424.11). M96684 H.sapiens Pur (pur-alpha) mRNA, complete cds. AI204040 qe77f05.x1 Soares_fetal_lung_NbHL19W Homo sapiens cDNA clone AA577923 nl20a01.s1 NCI_CGAP_HSC1 Homo sapiens cDNA clone IMAGE:1041192, AA569633 nm38h09.s1 NCI_CGAP_Pr4.1 Homo sapiens cDNA clone IMAGE:1062497, U65011 Human preferentially expressed antigen of melanoma (PRAME) mRNA, U21910 Human basic transcription factor BTF2p44 mRNA, 3′ end, partial cds. AA633187 nq07c12.s1 NCI_CGAP_Lu1 Homo sapiens cDNA clone IMAGE:1143190 3′ AF000993 Homo sapiens ubiquitous TPR motif, X isoform (UTX) mRNA, W76105 zd65b04.r1 Soares_fetal_heart_NbHHI9W Homo sapiens cDNA clone H39906 yo54a07.r1 Soares breast 3NbHBst Homo sapiens cDNA clone AA971717 op95c11.s1 NCI_CGAP_Lu5 Homo sapiens cDNA clone IMAGE:1584596 3′, M68891 Human GATA-binding protein (GATA2) mRNA, complete cds. AA310157 EST181013 Jurkat T-cells V Homo sapiens cDNA 5′ end, mRNA sequence.X00948 Human mRNA for prepro-relaxin H2. AB018330 Homo sapiens mRNA for KIAA0787 protein, partial cds. AA890637 ak11e11.s1 Soares_parathyroid_tumor_NbHPA Homo sapiens cDNA clone M64929 J05 Human protein phosphatase 2A alpha subunit mRNA, complete cds. W24341 zb81h12.r1 Soares_senescent_fibroblasts_NbHSF Homo sapiens cDNA AA974479 od58b03.s1 NCI_CGAP_GCB1 Homo sapiens cDNA clone IMAGE:1372109 3′ R31644 yh69e05.r1 Soares placenta Nb2HP Homo sapiens cDNA clone AA573246 nm52c02.s1 NCI_CGAP_Br2 Homo sapiens cDNA clone IMAGE:1071842 3′, AA507635 ng84b02.s1 NCI_CGAP_Pr6 Homo sapiens cDNA clone IMAGE:941451, mRNA gb|AF008915 Homo sapiens EVI5 homolog mRNA AL049987 Homo sapiens mRNA; cDNA DKFZp564F112 (from clone DKFZp564F112). U81599 Homo sapiens homeodomain protein HOXB13 mRNA AA641596 nr20f05.s1 NCI_CGAP_Pr2 Homo sapiens cDNA clone IMAGE:1168545, mRNA D84295 Human mRNA for possible protein TPRDII R13859 yf65d08.r1 Soares infant brain 1NIB Homo sapiens cDNA clone M34840 Human prostatic acid phosphatase mRNA, complete cds. AA572913 nm42f12.s1 NCI_CGAP_Pr4.1 Homo sapiens cDNA clone IMAGE:1062863, AA094460 cp0378.seq.F Human fetal heart, Lambda ZAP Express Homo sapiens AF031166 Homo sapiens SRp46 splicing factor retropseudogene mRNA. AA625147 af70c07.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:1047372 T39510 ya06h07.r1 Stratagene placenta (#937225) Homo sapiens cDNA clone R35034 yg60h03.r1 Soares infant brain 1NIB Homo sapiens cDNA clone AI003674 zg01c04.s1 Soares_pineal_gland_N3HPG Homo sapiens cDNA clone AJ003636 AJ003636 Selected chromosome 21 cDNA library Homo sapiens cDNA AA601385 no16d12.s1 NCI_CGAP_Phe1 Homo sapiens cDNA clone IMAGE:1100855 3′, AF191339 Homo sapiens anaphase-promoting complex subunit 5 (APC5) AA431822 zw79d02.r1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:782403 NM_003909 Homo sapiens copine III (CPNE3) AA484004 ne73f04.s1 NCI_CGAP_Ew1 Homo sapiens cDNA clone IMAGE:909919 AA535774 nj78f08.s1 NCI_CGAP_Pr10 Homo sapiens cDNA clone IMAGE:998631, mRNA NM_000944.1 Homo sapiens protein phosphatase 3 (formerly 2B) AA702811 zi90c11.s1 Soares_fetal_liver_spleen_1NFLS_S1 Homo sapiens cDNA X95073 H.sapiens mRNA for translin associated protein X. AA029039 zk12b07.s1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone AF032887 Homo sapiens forkhead (FKHRL1P1) pseudogene N46609 yy48h08.r1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA U58855 Homo sapiens soluble guanylate cyclase large subunit (GC-S-alpha-1) AA255486 zr83d03.s1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:682277 AA128153 zl15c06.s1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone AA016039 ze31c05.s1 Soares retina N2b4HR Homo sapiens cDNA clone R88520 ym91e09.s1 Soares adult brain N2b4HB55Y Homo sapiens cDNA clone M26624 Human CALLA/NEP gene encoding neutral endopeptidase, exon 20. AA026997 ze99e01.r1 Soares_fetal_heart_NbHH19W Homo sapiens cDNA clone W48775 zc44b08.r1 Soares_senescent_fibroblasts_NbHSF Homo sapiens cDNA AA074407 zm15c08.r1 Stratagene pancreas (#937208) Homo sapiens cDNA clone L13972 Homo sapiens beta-galactoside alpha-2,3-sialyltransferase (SIAT4A) D14661 Human mRNA for KIAA0105 gene, complete cds. AA115452 zk89a08.r1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone AA495742 zw04b12.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:768287 5′ R13416 yf75h09.r1 Soares infant brain 1NIB Homo sapiens cDNA clone AA046369 zk77h07.r1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone T35440 EST85129 Human Lung Homo sapiens cDNA 5′ end similar to None, mRNAAI075860 oz25b05.x1 Soares_total_fetus_Nb2HF8_9w Homo sapiens cDNA clone W56437 zc57g05.r1 Soares_parathyroid_tumor_NbHPA Homo sapiens cDNA clone AI583880 tt70b02.x1 NCI_CGAP_HSC3 Homo sapiens cDNA clone IMAGE:2246091 3′ D85181 Homo sapiens mRNA for fungal sterol-C5-desaturase homolog, complete AF105714 Homo sapiens protein kinase PITSLRE (CDC2L2) gene, exon 3.AA401802 zt60c12.r1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:726742 AB002301 Human mRNA for KIAA0303 gene, partial cds. U75667 Human arginase II mRNA, complete cds. AA585183 JTH089 HTCDL1 Homo sapiens cDNA 5′/3′, mRNA sequence.AF191771 Homo sapiens CED-6 protein (CED-6) mRNA AA650252 ns93g05.s1 NCI_CGAP_Pr3 Homo sapiens cDNA clone IMAGE:1191224, mRNA R64618 yi19b09.r1 Soares placenta Nb2HP Homo sapiens cDNA clone N24627 yx89a09.s1 Soares melanocyte 2NbHM Homo sapiens cDNA clone AB028951 Homo sapiens mRNA for KIAA1028 protein N75608 yw37a07.r1 Morton Fetal Cochlea Homo sapiens cDNA clone N53899 yy98e03.r1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA N46696 yy50f07.r1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA AA419522 zv03d05.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:752553 M61906 Human P13-kinase associated p85 mRNA sequence. C16570 C16570 Clontech human aorta polyA + mRNA (#6572) Homo sapiens cDNA X63105 H.sapiens tpr mRNA. AA315855 EST187656 Colon carcinoma (HCC) cell line II Homo sapiens cDNA 5′L18920 Human MAGE-2 gene exons 1-4, complete cds. M25161 Human Na,K-ATPase beta subunit (ATP1B) gene AA164865 zq41g07.r1 Stratagene hNT neuron (#937233) Homo sapiens cDNA clone N40094 yx98g07.r1 Soares melanocyte 2NbHM Homo sapiens cDNA clone N98940 yy71a07.r1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA AF049907 Homo sapiens zinc finger transcription factor (ZNF-X) mRNA, M78806 EST00954 Hippocampus, Stratagene (cat. #936205) Homo sapiens cDNA AA040819 zk47b03.r1 Soares_pregnant_uterus_NbHPU Homo sapiens cDNA clone C15445 C15445 Clontech human aorta polyA + mRNA (#6572) Homo sapiens cDNA AB018309 Homo sapiens mRNA for KIAA0766 protein, complete cds. AJ011497 Homo sapiens mRNA for Claudin-7. X00949 Human mRNA for prepro-relaxin H1. AA418633 zv93d09.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:767345 5′ AI146806 qb83h04.x1 Soares_fetal_heart_NbHH19W Homo sapiens cDNA clone X82942 H.sapiens satellite 3 DNA.AA456383 aa14f03.r1 Soares_NhHMPu_S1 Homo sapiens cDNA clone IMAGE:813245 AA019341 ze57e04.s1 Soares retina N2b4HR Homo sapiens cDNA clone AB027466 Homo sapiens SPON2 mRNA for spondin 2AF038170 Homo sapiens clone 23817 mRNA sequence. NM_000240 Homo sapiens monoamine oxidase A (MAOA) N34126 yx76c01.r1 Soares melanocyte 2NbHM Homo sapiens cDNA clone N41339 yw68g06.r1 Soares_placenta_8to9weeks_2NbHP8to9W Homo sapiens cDNA R34783 yh87b05.r1 Soares placenta Nb2HP Homo sapiens cDNA clone N75858 yw32a03.r1 Morton Fetal Cochlea Homo sapiens cDNA clone AA633887 ac32h04.s1 Stratagene hNT neuron (#937233) Homo sapiens cDNA clone N53723 yz06d03.r1 Soares_multiple_sclerosis_2NbHMSP Homo sapiens cDNA AI187365 qf29b12.x1 Soares_testis_NHT Homo sapiens cDNA clone IMAGE:1751423 -
TABLE 5 Genes/ESTs as Defined by Publications: Including Androgen Signaling, Prostate Specificity, Prostate Cancer Association, and Nuclear Receptors/Regulators with Potential Interaction with Androgen Receptor Cluster ID Gene Name Description References Hs.81988 DOC-2 deliion of ovarian Up-regulated by Androgen Ablation Endocrinology, carcinoma 2 139, 3542, 98 Hs.155389 RAR a Up-regulated by Androgen Ablation endocrinology, 138, 553, 97 Hs.12601 AS3 DNA binding protein Up-regulated by Androgen Ablation J Steroid Biochem Mol Biol 68, 41, 99 Hs.181426 EST Up-regulated by Androgen Ablation Hs.2391 apical protein Up-regulated by Androgen Ablation Hs.109530 KGF/FGF7 keratinocyte growth Up-regulated by Androgen BBRC 220, 858, 96, factor Can Res, 54, 5474, 94 Hs.1104 TGF beta 1 Up-regulated by Androgen Endocrinology, 137, 99, 96, Endocrinology, 139, 378, 98 Hs.75525 Calreticulin Calreticulin Up-regulated by Androgen Can Res 59, 1896, 99 Hs.78888 DBI/ACBP Diazepam-binding Up-regulated by Androgen JBC, 237, 19938, 98 inhibitor/acyl-CoA binding Protein Hs.41569 Phosphatidic acid Up-regulated byAndrogen JBC, 273, 4660, 98 phosphatase type 2a isozyme Hs.83190 Fatty acid synthase Up-regulated by Androgen Can Res, 57, 1086, 97 Hs.99915 Androgen Receptor Up-regulated by Androgen Steroids 9, 531, 96 Hs.2387 prostate-restricted Up-regulated by Androgen Biochem J 315, 901, 96 transglutaminase Hs.78996 PCNA proliferating cell Up-regulated by Androgen Can Res 56, 1539, 96 nuclear antigen Hs.74456 GAPDH Up-regulated by Androgen Can Res 55, 4234, 95 Hs.82004 E cadherin Up-regulated by Androgen BBRC, 212, 624, 95 Hs.57710 AIGF Androgen-induced Up-regulated by Androgen FEBS lett 363, 226, 95 growth factor Hs.118618 MIC2 humanpseudoauto- Up-regulated by Androgen Mol Carcinog, somal gene? 23, 13, 98 Hs.18420 Talin cytoskeletal protein Up-regulated by Androgen FEBS lett 434, 66, 98 Hs. 54502 clathrin heavy chain Up-regulated by Androgen Endocrinology, 139, 2111, 98 Hs.73919 clathrin light chain b Up-regulated by Androgen Endocrinology, 139, 2111, 98 Hs.76506 L-plastin ESTs. Moderately Up-regulated by Androgen Am J Pathol, 150, similar to L- 2009, 97 PLASTIN [H.sapiens] Hs.82173 EGR alpha TGFB inducible early Up-regulated by Androgen Mol Endocrinol, growth response 9, 1610, 95 ND FGF10 Up-regulated by Androgen JBC, 274, 12827, 99 Hs.107169 IGFBP5 Up-regulated by Androgen Endocrinology, 140, 237 2, 99 Hs.179665 p21 Up-regulated by Androgen Mol Endocrinol, 13, 376, 99 Hs.51117 BMP-7 Up-regulated by Androgen Prostate, 37, 236, 98 Hs.73793 VEGF vascular endothelial Up-regulated by Androgen Endocrinol, 139, 4672, 9 growth factor 8, BBRC, 251, 287, 98 Hs.166 SREBPs sterol regulatory Up-regulated by Androgen J Steroid Biochem Mol element binding Biol, 65, 191, 98 transcription factor 1 Hs.116577 PDF prostate Up-regulated by Androgen JBC, 273, 13760, 98 differentiation factor Hs.1905 prolactin Prolactin Up-regulated by Androgen FEBS J, 11, 1297, 97 Hs.19192 CDK2 Up-regulated by Androgen Can Res, 57, 4511, 97 Hs.95577 CDK4 cyclin-dependent Up-regulated by Androgen Can Res, 57, 4511, 97 kinase 4 Hs.183596 UGT2B17 uridine Up-regulated by Androgen Endocrinology, diphosphoglucronosyl 138, 2998, 97 transferase Hs.150207 UGT2B15 UDP- Up-regulated by Androgen Can Res 57, 4075, 97 glucronosyltransferase 2B15 ND prostate binding protein Up-regulated by Androgen PNAS, 94, 12999, 97 C2A (RAT) ND Probasin (RAT) Up-regulated by Androgen PNAS, 94, 12999, 97 Hs.7719 prostatein C3 (RAT) Up-regulated by Androgen PNAS, 94, 12999, 97 ND Cystatin related protein 1 Up-regulated by Androgen PNAS, 94, 12999, 97 (RAT) ND Cystatin related protein 2 Up-regulated by Androgen PNAS, 94, 12999, 97 (RAT) Hs.394 Adrenomedulin (RAT) Up-regulated by Androgen PNAS, 94, 12999, 97 Hs.77393 farnesyl diphosphate Up-regulated by Androgen PNAS, 94, 12999, 97 synthase (famesyl pyrophosphate synthetase, dimethylallyltranstrans- ferase) Hs.153468 LDL receptor (Rat) Up-regulated by Androgen PNAS, 94, 12999, 97 ND. Hysto-blood group A Up-regulated by Androgen PNAS, 94, 12999, 97 transferase (RAT) Hs.196604 Sex limited protein Up-regulated by Androgen PNAS, 94, 12999, 97 (RAT) slp ND prostatic spermine Up-regulated by Androgen Mol Cell Endocrinol, binding protein (RAT) 108, R1, 95 Hs.76353 Protein C Inhibitor Up-regulated by Androgen FEBS lett, 492, 263, 98 Hs.203602 enolase alpha Up-regulated by Androgen Can Res, 58, 5718, 98 Hs.169476 tubulin alpha Up-regulated by Androgen Can Res, 58, 5718, 98 Hs.184572 Cdk1 Up-regulated by Androgen Can Res, 58, 5718, 98 Hs.107528 EST EST similar to Up-regulated by Androgen androgen-regulated protein FAR-17 Hs.28309 UDP-glucose Up-regulated by Androgen Endocrinology, dehydrogenase 140, 10, 4486, (99) Hs.194270 secretory component Up-regulated by Androgen Mol endocrinol, gene 13, 9, 1558, (99) Hs.76136 Thioredoxin Up-regulated by Androgen J steroid Biochem Mol Biol, 68, 5-6, 203, (99) Hs.3561 p27 Kip1 cyclin-dependent Up-regulated by Androgen Mol kinase inhibitor 1B Endocrinol, 12, 941, 98 (p27, Kip1) Hs.1867 progastricsin Up-regulated by Androgen J.B.C. 271, 15175, (99) (pepsinogen C) Hs.97411 hamster Androgen- Up-regulated by Androgen Genebank dependent Expressed Protein like protein gene Hs.155140 Protein kinase CK2 casein kinase 2, alpha Translocated by Androgen Can Res 59, 1146, 99 1 polypeptide IMAGE.95326 DD3 Prostate Specific Eur Urol, 35, 408, 99 2 Hs.218366 Prostase Prostate Specific PNAS, 96, 3114, 99 Hs.20166 PSCA prostate stem cell Prostate Specific PNAS, 95, 1735, 98 antigen Hs.171995 PSA kallikrein 3, (prostate Prostate Specific PNAS, 95, 300, 98, specific antigen) DNA Cell Biol. 16, 627, 97 Hs.183752 PSSPP prostate-secreted Prostate Specific PNAS, 95, 300, 98 seminal plasma protein, nc50a10, microsemnoprotein beta, PSP94 Hs.1852 PAP prostatic acid Prostate Specific PNAS, 95, 300, 98 phosphatase Hs.52871 SYT Prostate Specific PNAS, 95, 300, 98 Hs.158309 Homoobox HOX D13 Prostate Specific PNAS, 95, 300, 98 Hs.1968 Semenogelin 1 Prostate Specific PNAS, 95, 300, 98 Hs.76240 Adenylate kinase adenylate kinase 1 Prostate Specific PNAS, 95, 300, 98 isoenzyme 1 Hs.184376 SNAP23 Prostate Specific PNAS, 95, 300, 98 Hs.82186 ERBB-3 receptor Prostate Specific PNAS, 95, 300, 98 protein-tyrosin kinase Hs.180016 Semenogelin 2 Prostate Specific Hs.1915 PSMA folate hydrolase Prostate Specific (prostate-specific membrane antigen) 1 Hs.181350 KLK2 Prostate Specific Hs.73189 NKX3.1 Prostate Specific HPARJ1 Prostate Specific IMAGE:56577 9 Hs.76053 p68 RNA helicase Potential interaction with AR MCB, 19, 5363, (99) Hs.111323 ARIP3 Potential interaction with AR JBC, 274, 3700, 99 Hs.25511 ARA54 Potential interaction with AR JBC274, 8319, 99 Hs.28719 ARA55 Potential interaction with AR JBC, 274, 8570, 99 HS.999908 ARA70 Potential interaction with AR PNAS, 93, 5517, 96 Hs.29131 TIF2 transcriptional Potential interaction with AR EMBO, 15, 3667, 96, intermediary factor 2 EMBO, 17, 507, 98 Hs.66394 SNURF ring finger protein 4 Potential interaction with AR MCB, 18, 5128, 98 Hs.75770 RB retinoblastoma 1 Potential interaction with AR (including osteosarcoma) Hs.74002 SRC-1 steroid receptor Potential interaction with AR coactivator 1 Hs.155017 RIP140 nuclear receptor Potential interaction with AR EMBO, 14, 3741, 95, interacting protein 1 Mol Endocrinol, 12, 864, 98 Hs.23598 CBP CREB binding Potential interaction with AR protein (Rubinstein- Taybi syndrome) Hs.25272 p300 EIA binding protein Potential interaction with AR p300 Hs.78465 c-JUN Potential interaction with AR Hs.199041 ACTR AIB1, mouse Potential interaction with AR M.C.B, 17, 2735, 97, GRIP1, pCIP PNAS, 93, 4948, 96 Hs.6364 TIP60 Human tat interactive Potential interaction with AR JBC, 274, 17599, 99 protein mRNA, complete cds Hs.32587 SRA Potential interaction with AR Cell, 97, 17, 99 Hs.155302 PCAF Potential interaction with AR Hs.10842 ARA24 Potential interaction with AR Hs.41714 BAG-1L Potential interaction with AR JBC, 237, 11660, 98 Hs.82646 dnaJ, HSP40 DNAJ PROTEIN Potential interaction with AR HOMOLOG 1 Hs.43697 ERM ets variant gene 5 Potential interaction with AR JBC, 271, 23907, 96 (ets-related molecule) Hs.75772 GR Potential interaction with AR JBC, 272, 14087, 97 Hs.77152 MCM7 Potential interaction with AR ND NJ Potential interaction with AR ND RAF Potential interaction with AR JBC, 269, 20622, 94 ND TFIIF Potential interaction with AR PNAS, 94, 8485, 97 Hs.90093 hsp70 Potential interaction with AR Hs.206650 hsp90 Potential interaction with AR Hs.848 hsp56(FKBP52, Potential interaction with AR FKBP59, HBI)) Hs.143482 Cyp40(cyclophilin40) Potential interaction with AR p23 Potential interaction with AR Hs.84285 ubiquitin-conjugating Potential Interaction with AR J.B.C.274, 19441(99) enzyme Hs.182237 POU domain, class 2, Potential interaction with AR transcr Hs.1101 POU domain, class 2, Potential interaction with AR transcr Hs.2815 POU domain, class 6, Potential interaction with AR transcr IMAGE:14199 Potential interaction with AR 81 Hs.227639 ARA160 Potential interaction with AR JBC, 274, 22373(99) Hs.83623 CAR-beta Xist locus Nuclear receptor gene family Hs.2905 PR Nuclear receptor gene family Hs.1790 MR mineralocorticoid Nuclear receptor gene family receptor (aldosterone receptor) Hs.1657 ER alpha Nuclear receptor gene family Hs.103504 ER beta Nuclear receptor gene family Hs.110849 ERR1 Nuclear receptor gene family Hs.194667 ERR2 Nuclear receptor gene family Hs.724 TR a thyroid hormone Nuclear receptor gene family receptor, alpha (avian erythroblastic leukemia viral (v-erb- a) oncogene homolog) Hs.121503 TR b Nuclear receptor gene family Hs.171495 RAR b retinoic acid receptor, Nuclear receptor gene family beta Hs.1497 RAR g retinoic acid receptor, Nuclear receptor gene family gamma Hs.998 PPAR a Nuclear receptor gene family Hs.106415 PPAR b Human peroxisome Nuclear receptor gene family proliferator activated receptor mRNA, complete cds Hs.100724 PPAR g peroxisome Nuclear receptor gene family proliferative activated receptor, gamma Hs.100221 LXR b Nuclear receptor gene family Hs.81336 LXR a liver X receptor, Nuclear receptor gene family alpha Hs.171683 FXR farnesoid X-activated Nuclear receptor gene family receptor Hs.2062 VDR vitamin D (1, 25- Nuclear receptor gene family dihydroxyvitamin D3) receptor Hs.118138 PXR Nuclear receptor gene family ND SXR Nuclear receptor gene family ND BXR Nuclear receptor gene family ND CAR b? CAR a Nuclear receptor gene family Hs.196601 RXRA Nuclear receptor gene family Hs.79372 RXRB Human retinoid X Nuclear receptor gene family receptor beta (RXR- beta) mRNA, complete cds Hs.194730?TR EAR1 Nuclear receptor gene family 1? Hs.204704 EAR1 beta Nuclear receptor gene family E75 Nuclear receptor gene family Hs.2156 ROR alpha Nuclear receptor gene family Hs.198481 ROR beta Nuclear receptor gene family Hs.133314 ROR gammma Nuclear receptor gene family Hs.100221 NER1 Nuclear receptor gene family Hs.54424 HNF4A Nuclear receptor gene family Hs.202659 HNF4G Nuclear receptor gene family Hs.108301 TR2 Nuclear receptor gene family Hs.520 TR4 Nuclear receptor gene family Hs.144630 COUP-TF1 Nuclear receptor gene family Hs.1255 COUP-TF2 Nuclear receptor gene family Hs.155286 EAR2 Nuclear receptor gene family Hs.1119 TR3 hormone receptor Nuclear receptor gene family (growth factor- inducible nuclear protein N10) Hs.82120 NURR1 IMMEDIATE- Nuclear receptor gene family EARLY RESPONSE PROTEIN NOT Hs.97196 SF1 Nuclear receptor gene family Hs.183123 FTF fetoprotein- alpha 1Nuclear receptor gene family (AFP) transcription factor Hs.46433 DAX1 Nuclear receptor gene family Hs.11930 SHP Homo sapiens nuclear Nuclear receptor gene family hormone receptor (shp) gene, 3′ end of cds Hs.83623, CAR-beta Nuclear receptor gene family IMAGE 1761923, or 1868028, or 1563505, or 1654096 Hs.199078 Sin3 Nuclear receptor co-repressor complex Nature, 387, 43, 97. Nature, 387, 49, 97 Hs.120980 SMRT Nuclear receptor co-repressor complex Nature, 377, 454, 95 Hs.144904 N-CoR Nuclear receptor co-repressor complex Nature, 377, 297, 95 Hs.188055 highly homologue gene Nuclear receptor co-repressor complex to N-CoR in prostate and testis Hs.180686 E6-AP Angelman syndrome Nuclear receptor co-activator complex MCB, 19, 1182, 99 associated protein Hs.199211?Hs. hBRM ESTs, Highly similar Nuclear receptor co-activator complex 198296? to HOMEOTIC GENE REGULATOR [Drosophila melanogaster] Hs.78202 hBRG1 Nuclear receptor co-activator complex Hs.11861 TRAP240 DRIP250, ARCp250 Nuclear receptor co-activator complex Mol Cell, 3, 361, 99 Hs.85313 TRAP230 ARCp240, DRIP240 Nuclear receptor co-activator complex Mol Cell, 3, 361, 99 Hs.15589 TRAP220 RB18A, PBP, Nuclear receptor co-activator complex CRSP200, TRIP2, ARCp205, DRIP205 Hs.21586 TRAP170 RGR, CRSP150, Nuclear receptor co-activator complex DRIP150, ARCp150chromosom eX Hs.108319 TRAP150 ESTs Nuclear receptor co-activator complex Mol Cell, 3, 361, 99 Hs.193017 CRSP133 ARCp130, DRIP130 Nuclear receptor co-activator complex Nature, 397, 6718, 99 Hs.23106 TRAP100 ARCp100, DRIP100, Nuclear receptor co-activator complex ND DRIP97 TRAP97 Nuclear receptor co-activator complex Hs.24441 TRAP95 ESTs Nuclear receptor co-activator complex Mol Cell, 3, 361, 99 ND TRAP93 Nuclear receptor co-activator complex Hs.31659 DRIP92 ARCp92? Nuclear receptor co-activator complex Hs.22630 TRAP80 ARCp77, Nuclear receptor co-activator complex Mol Cell, 3, 361, 99 CRSP77, DRIP80(77)? Hs.204045 ARCp70 CRSP70, DRIP79 Nuclear receptor co-activator complex ND ARCp42 Nuclear receptor co-activator complex ND ARCp36 Nuclear receptor co-activator complex Hs.184947 MED6 ARCp33 Nuclear receptor co-activator complex Mol Cell, 3, 97, 99 Hs.7558 MED7 CRSP33, ARCp34, Nuclear receptor co-activator complex Nature, 397, 6718, 99 DRIP36 ND ARCp32 Nuclear receptor co-activator complex ND SRB10 Nuclear receptor co-activator complex ND SRB11 Nuclear receptor co-activator complex ND MED10 NUT2 Nuclear receptor co-activator complex Hs.27289 SOH1 (yeast?) Nuclear receptor co-activator complex Mol Cell, 3, 97, 99 ND p26 Nuclear receptor co-activator complex ND p28 Nuclear receptor co-activator complex ND p36 Nuclear receptor co-activator complex ND p37 Nuclear receptor co-activator complex ND but 2 TRFP human homologue of Nuclear receptor co-activator complex IMAGE clones Drosophila TRF proximal protein ND VDR interacting subunit 180kDa, HAT Nuclear receptor co-activator complex Genes Dev, 12, 1787, 98 activity Hs.143696, or Coactivator associated Nuclear receptor co-activator complex Science, 284, 2174, 99 IMAGE:23716 methyltransferase 196? Hs.79387 SUG1 TRIP1 Nuclear receptor co-activator complex EMBO, 15, 110, 96 ND TRUP Nuclear receptor co-activator complex PNAS, 92, 9525, 95 Hs.28166 CRSP34 Nuclear receptor co-activator complex Nature, 397, 6718, 99 Hs.63667 transcriptional adaptor 3 Nuclear receptor co-activator complex (A Hs.196725 ESTs, Highly similar to Nuclear receptor co-activator complex P300 Hs.131846 PCAF associated factor Nuclear receptor co-activator complex 65 al Hs.155635 ESTs, Moderately Nuclear receptor co-activator complex similar toPCAF associated factor 65 beta Hs.26782 PCAF associated factor Nuclear receptor co-activator complex 65 beta Hs.118910 tumor suscitibility Modifying AR function Cancer 15, 86, 689, protein 101 (99) Hs.82932 Cyclin D1 cyclin D1 (PRAD1: Modifying AR function Can Res, 59, 2297, 99 parathyroid adenomatosis 1) Hs.173664 HER2/Neu v-erb-b2 avian Modifying AR function PNAS, 9, 5458, 99 erythroblastic leukemia viral oncogene homolog 2 Hs.77271 PKA protein kinase, Modifying AR function JBC 274, 7777, 99 cAMP-dependent, catalytic, alpha Hs.85112 IGF1 insulin-like growth Modifying AR function Can Res, 54, 5474, 94 factor 1 (somatomedin C) Hs.2230 EGF Modifying AR function Can Res, 54, 5474, 94 Hs.129841 MEKK1 MAPKKK1 Modifying AR function Mol Cell Biol. 19, 5143, 99 Hs.83173 Cyclin D3 Modifying AR function Can Res, 59, 2297, 99 Hs.75963 IGF2 Modifying AR function Hs.89832 Insulin Modifying AR function Hs.115352 GH Modifying AR function Hs.1989 5 alpha reductase type2 Involved in Androgen metabolism Hs.76205 Cytochrome P450, Involved in Androgen metabolism subfamily XIA Hs.1363 Cytochrome P450, Involved in Androgen metabolism subfamily XVII, (steroid 17-alpha-hydroxylase), Hs.477 Hydroxysteroid (17- Involved in Androgen metabolism beta) dehydrogenase 3 Hs.75441 Hydroxysteroid (17- Involved in Androgen metabolism beta) dehydrogenase 4 Hs.38586 Hydroxy-delta-5-steroid Involved in Androgen metabolism dehydrogenase, 3 beta- and steroid delta- isomerase 1 Hs.46319 Sex hormone-binding Involved in Androgen metabolism globulin Hs.552 SRD5A1 Involved in Androgen metabolism Hs.50964 C-CAM epithelial cell Down-regulated by Androgen Oncogene, 18, 3252, 99 adhesion molecule Hs.7833 hSP56 selenium binding Down-regulated by Androgen Can Res, 58, 3150, 98 protein Hs.77432 EGFR epidermal growth Down-regulated by Androgen Endocrinology, factor receptor 139, 1369, 98 Hs.1174 p16 Down-regulated by Androgen Can Res.57, 4511, 97 Hs.55279 maspin Down-regulated by Androgen PNAS, 94, 5673, 97 Hs.75789 TDD5 (mouse) Human mRNA for Down-regulated by Androgen PNAS, 94, 4988, 97 RTP, complete cds Hs.75106 TRPM-2 clusterin Down-regulated by Androgen (testosterone-repressed prostate message 2, apolipoprotein J) Hs.25640 rat ventral prostate gene1 claudin3 Down-regulated by Androgen PNAS, 94, 12999, 97 ND glutathione S-transferase Down-regulated by Androgen PNAS, 94, 12999, 97 Hs.25647 c-fos v-fos FBJ murine Down-regulated by Androgen PNAS, 94, 12999, 97 osteosarcoma viral oncogene homolog N.D. matrix carboxyglutamic Down-regulated by Androgen PNAS, 94, 12999, 97 acid protein (RAT) Hs.2962 S100P calcium binding Down-regulated by Androgen Prostate 29, 350, 96 prottein Hs.75212 ornithine decarboxilase ornithine Down-regulated by Androgen J Androl, 19, 127, 98 decarboxylase 1 Hs.84359 Androge withdrawal Down-regulated by Androgen apoptosis RVP1 Hs.79070 c-myc v-myc avian Down-regulated by Androgen myelocytomatosis viral oncogene homolog Hs.139033 partially expressed gene Down-regulated by Androgen Mol Cell Endocrinol 3 155, 69, (99) Hs.20318 PLU-1 Associated with Prostate Cancer JBC, 274, 15633, 99 Hs.18910 POV1(PB39) unique Associated with Prostate Cancer Genomics. 51, 282, 98 Hs.119333 caveolin Associated with Prostate Cancer Clin Can Res. 4, 1873, 98 ND, but 1 EST R00540(2.6kbp) = IM Associated with Prostate Cancer Urology, 50, 302, 97 IMAGE AGE:123822 CLONE Hs.184906 PTI-1 prostate tumor Associated with Prostate Cancer Can Res, 57, 18, 97, inducing gene, PNAS, 92, 6778, 95 trancated and mutated human elongation factor 1 alpha Hs.74649 cytochrome c oxidase Associated with Prostate Cancer Can Res, 56, 3634, 96 subunit VI c Hs.4082 PCTA-1 prostate carcinoma Associated with Prostate Cancer PNAS, 92, 7252, 96 tumor antigen, galectin family ND pp32r1 Associated with Prostate Cancer Nature Medicine, 5, 275, 99 ND pp32r2 Associated with Prostate Cancer Nature Medicine, 5, 275, 99 Hs.184945 GBX2 Associated with Prostate Cancer The prostate journal, 1, 61, 99 Hs.8867 Cyr61 inmmediate early Associated with Prostate Cancer Prostate, 36, 85, 98 protein Hs.77899 epithelial tropomyosin actin binding protein Associated with Prostate Cancer Can Res, 56, 3634, 96 Hs.76689 pp32 Associated with Prostate Cancer Nature Medicine, 5, 275, 99 Hs.10712 PTEN Associated with Prostate Cancer Hs.194110 KAII Associated with Prostate Cancer Hs.37003 H-ras Associated with Prostate Cancer Hs.184050 K-ras Associated with Prostate Cancer Hs.69855 N-ras neuroblastoma RAS Associated with Prostate Cancer viral (v-ras) oncogene homolog Hs.220 TGFbeta receptor 1 Associated with Prostate Cancer Hs.77326 IGFBP3 insulin-like growth Associated with Prostate Cancer factor binding protein 3 Hs.79241 bcl-2 Associated with Prostate Cancer Hs.159428 Bax Associated with Prostate Cancer Hs.206511 bcl-x Associated with Prostate Cancer Hs.86386 mcl-1 myeloid cell leukemia Associated with Prostate Cancer sequence 1 (BCL2- related) Hs.1846 p53 tumor protein p53 Associated with Prostate Cancer (Li-Fraumeni syndrome) Hs38481 CDK6 cyclin-dependent Associated with Prostate Cancer kinase 6 Hs.118630 Mxi.1 Associated with Prostate Cancer Hs.184794 GAGE7 Associated with Prostate Cancer Hs.118162 fibronectin Associated with Prostate Cancer Am J Pathol 154, 1335, 99 Hs.128231 PAGE-1 Associated with Prostate Cancer JBC, 237, 17618, 98 Hs.75875 UEV1 ubiquitin-conjugating Associated with Prostate Cancer Am J Pathol enzyme E2 variant 1 154, 1335, 99 Hs.75663 PM5 Human mRNA for Associated with Prostate Cancer Am J Pathol pM5 protein 154, 1335, 99 Hs.180842 BBC1 breast basic Associated with Prostate Cancer Am J Pathol conserved gene 154, 1335, 99 Hs.198024 JC19 Associated with Prostate Cancer Can Res 57, 4075, 97 N.D. GC79 novel gene Associated with Prostate Cancer Can Res 57, 4075, 97 Hs.77054 B cell translocation gene Associated with Prostate Cancer Can Res 57, 4075, 97 1 Hs.78122 Regulatory factor X- Associated with Prostate Cancer associated ankyrin- containing protein Hs.3337 transmembrane 4Associated with Prostate Cancer superfamily member 1 Hs.76698 TL5 Associated with Prostate Cancer Genebank Hs3776 TL7 Associated with Prostate Cancer Genebank Hs.170311 TL35 Associated with Prostate Cancer Genebank Hs.184914 Human mRNA for TI- Associated with Prostate Cancer 227H Hs.62954 ferritin, heavy Associated with Prostate Cancer polypeptide Hs.71119 N33 Associated with Prostate Cancer Genomics, 35, 45(96) -
TABLE 6 Genes/ESTs as defined by publications: Differentially expresed genes in prostate cancer from CGAP database (NIH) Cluster.ID Gene name Hs.179809 EST Hs.193841 EST Hs.99949 prolactin-induced protein Hs.101307 EST Hs.111256 arachidonate 15-lipoxygenase Hs.185831 EST Hs.115173 EST Hs.193988 EST Hs.159335 EST Hs.191495 EST Hs.187694 EST Hs.191848 EST Hs.193835 EST Hs.191851 EST Hs.178512 EST Hs.222886 EST Hs.210752 EST Hs.222737 EST Hs.105775 EST Hs.115129 EST Hs.115671 EST Hs.116506 EST Hs.178507 EST Hs.187619 EST Hs.200527 EST Hs.179736 EST Hs.140362 EST Hs.209643 EST Hs.695559 EST Hs.92323 MAT8 Hs.178391 BTK Hs.55999 EST Hs.171185 Desmin Hs.54431 SGP28 Hs.182624 EST Hs.112259 T cell receptor gammma Hs.76437 EST Hs.104215 EST Hs.75950 MLCK Hs.154103 LIM Hs.9542 JM27 Hs.153179 FABP5 Hs.195850 EST Hs.105807 EST Hs.115089 EST Hs.116467 EST Hs.222883 EST -
TABLE 7 Androgen regulated Genes Defined by CPDR Genes/ESTs Derived from CPDR-Genome Systems ARG Database Cluster Gene Name Description Hs.152204 TMPRSS2 Up-regulated by Androgen Hs.123107 KLK1 Up-regulated by Androgen Hs.173334 elongation factor ell2 Up-regulated by Androgen Hs.151602 epithelial V-like antigen Up-regulated by Androgen Hs.173231 IGFR1 Up-regulated by Androgen Hs.75746 aldehyde dehydrogenase 6 Up-regulated by Androgen Hs.97708 EST prostate and testis Up-regulated by Androgen Hs.94376 proprotein convertase subtilisin/kexin type 5 Up-regulated by Androgen AF017635 Homo sapiens Ste-20 related kinase SPAK mRNA, complete cds {Incyte PD: Up-regulated by Androgen 60737} Hs.2798 leukemia inhibitory factor receptor Up-regulated by Androgen Hs.572 orosomucoid 1 Up-regulated by Androgen Hs.35804 KIAA0032 gene product Up-regulated by Androgen Hs.114924 solute carrier family 16 (monocarboxylic acid transporters), member 6 Up-regulated by Androgen Hs.37096 zinc finger protein 145 (Kruppel-like, expressed in promyelocytic leukemia) Up-regulated by Androgen R07295 sterol O-acyltransferase (acyl-Coenzyme A: cholesterol acyltransferase) 1 Up-regulated by Androgen {Incyte PD: 2961248} Hs.11899 3-hydroxy-3-methylglutaryl-Coenzyme A reductase Up-regulated by Androgen Hs.216958 Human mRNA for KIAA0194 gene, partial cds Up-regulated by Androgen Hs.76901 for protein disulfide isomerase-related Up-regulated by Androgen Hs.180628 dynamin-like protein Up-regulated by Androgen Hs.81328 nuclear factor of kappa light polypeptide gene enhancer in B-cells inhibitor, Up-regulated by Androgen alpha Hs.159358 acetyl-Coenzyme A carboxylase alpha Up-regulated by Androgen N24233 IMAGE:262457 Up-regulated by Androgen Hs.188429 EST Up-regulated by Androgen Hs.77508 glutamate dehydrogenase 1 Up-regulated by Androgen Hs.12017 Homo sapiens KIAA0439 mRNA Up-regulated by Androgen Hs.10494 EST Up-regulated by Androgen Hs.20843 EST Up-regulated by Androgen Hs.153138 origin recognition complex, subunit 5 (yeast homolog)-like Up-regulated by Androgen Hs.79136 Human breast cancer, estrogen regulated LIV-1 protein (LIV-1) mRNA, partial Up-regulated by Androgen cds Hs.35750 anthracycline resistance-associated Up-regulated by Androgen Hs.56729 lymphocyte-specific protein 1 Up-regulated by Androgen Hs.17631 EST Up-regulated by Androgen Hs.46348 bradykinin receptor B1 Up-regulated by Androgen Hs.172851 arginase, type II Up-regulated by Androgen Hs.66744 twist (Drosophila) homolog Up-regulated by Androgen Hs.185973 membrane fatty acid (lipid) desaturase Up-regulated by Androgen Hs.26 ferrochelatase (protoporphyria) Up-regulated by Androgen Hs 169341 ESTs, Weakly similar to phosphatidic acid phosphohydrolase type-2c Up-regulated by Androgen [H. sapiens] Hs.119007 S-phase response (cyclin-related) Up-regulated by Androgen Hs.76285 H. sapiens gene from PAC 295C6, similar to rat PO44 Up-regulated by Androgen Hs.167531 Homo sapiens mRNA fill length insert cDNA clone EUROIMAGE 195423 Up-regulated by Androgen Hs.9817 arg/Abl-interacting protein ArgBP2 Up-regulated by Androgen Hs.28241 EST Down-regulated by Androgen Hs.25925 Homo sapiens clone 23860 mRNA Down-regulated by Androgen Hs.10319 UDP glycosyltransferase 2 family, polypeptide B7 Down-regulated by Androgen Hs.155995 Homo sapiens mRNA for KIAA0643 protein, partial cds Down-regulated by Androgen Hs.23552 EST Down-regulated by Androgen Hs.41693 DnaJ-like heat shock protein 40 Down-regulated by Androgen Hs.90800 matrix metalloproteinase 16 (membrane-inserted) Down-regulated by Androgen Hs.2996 sucrase-isomaltase Down-regulated by Androgen Hs.166019 regulatory factor X.3 (influences HLA class II expression) Down-regulated by Androgen Hs.27695 midline 1 (Opitz/BBB syndrome) Down-regulated by Androgen Hs.183738 chondrocyte-derived ezrin-like protein Down-regulated by Androgen Hs.75761 SFRS protein kinase 1 Down-regulated by Androgen Hs.197298 NS1-binding protein Down-regulated by Androgen Hs.149436 kinesin family member 5B Down-regulated by Androgen Hs.81875 growth factor receptor-bound protein 10 Down-regulated by Androgen Hs.75844 ESTs, Weakly similar to (define not available 5257244) [H. sapiens] Down-regulated by Androgen Hs.30464 cyclin E2 Down-regulated by Androgen Hs.198443 inositol 1, 4, 5-triphosphate receptor, type 1 Down-regulated by Androgen Hs.177959 a disintegrin and metalloproteinase domain 2 (fertilin beta) Down-regulated by Androgen Hs.44197 Homo sapiens mRNA; cDNA DKFZpS64D0462 (from clone Down-regulated by Androgen DKFZp564D0462) Hs.150423 cyclin-dependent kinase 9 (CDC2-related kinase) Down-regulated by Androgen Hs.78776 Human putative transmembrane protein (nma) mRNA, complete cds Down-regulated by Androgen Hs.25740 ESTs, Weakly similar to !!!! ALU SUBFAMILY SQ WARNING ENTRY !!!! Down-regulated by Androgen [H. sapiens] Hs.131041 EST Down-regulated by Androgen Hs.19222 ecotropic viral integration site 1 Down-regulated by Androgen Hs.9879 EST Down-regulated by Androgen Hs.118722 fucosyltransferase 8 (alpha (1, 6) fucosyltransferase) Down-regulated by Androgen Hs.47584 potassium voltage-gated channel, delayed-rectifier, subfamily S, member 3 Down-regulated by Androgen Hs.115945 mannosidase, beta A, lysosomal Down-regulated by Androgen Hs.171740 ESTs, Weakly similar to Zic2 protein [M. musculus] Down-regulated by Androgen Hs.32970 signaling lymphocytic activation molecule Down-regulated by Androgen Hs.196349 EST Down-reguiated by Androgen Hs.182982 Homo sapiens mRNA for KIAA0855 protein, partial cds Down-regulated by Androgen Hs.72918 small inducible cytokine A1 (1-309, homologous to mouse Tca-3) Down-regulated by Androgen Hs.84232 transcobalamin II; macrocytic anemia Down-regulated by Androgen Hs.10086 EST Down-regulated by Androgen Hs.1327 Butyrylcholinesterase Down-regulated by Androgen Hs.166684 serine/threonine kinase 3 (Ste20, yeast homolog) Down-regulated by Androgen AA558631 EST Down-regulated by Androgen Hs.150403 dopa decarboxylase (aromatic L-amino acid decarboxylase) Down-regulated by Androgen Hs.177548 postmeiotic segregation increased (S. cerevisiae) 2 Down-regulated by Androgen Hs.205902 IGF1-R Hs.21330 MDR1 P glycoprotein 1/multiple drug resistance 1 Hs.74427 PIG11 Homo sapiens Pig11 (PIG11) mRNA, complete cds Hs.76507 PIG7 LPS-induced TNF-alpha factor Hs.8141 PIG8 Hs.146688 PIG12 Hs.104925 PIG10 Hs.202673 PIG6 Hs.80642 STAT4 Hs.72988 STAT2 Hs.167503 STAT5A Hs.738 early growth response 1 Hs.85148 villin2 Hs.109012 MAD Hs.75251 DEAD/H box binding protein 1 Hs.181015 STAT6 Hs.199791 SSI-3 STAT induced STAT inhibitor 3 Hs.21486 STAT1 Hs.142258 STAT3 Hs.76578 PIAS3 Protein inhibitor of activated STAT3 Hs.44439 CIS4 STAT induced STAT inhibitor 4 Hs.50640 SSI-1 JAK binding protein Hs.54483 NMI N-Myc and STAT interactor Hs.105779 PIASy Protein inhibitor of activated STAT Hs.110776 STATI2 STAT induced STAT inhibitor 2 Hs.181112 EST similar to STAT5A -
TABLE 9 Functional Categories of ARGs Tag T/C Access # Name, Description Transcription Regulators GCCAGCCCAG (SEQ ID NO: 13) 11/1 H41030 KAP1/TIF1beta, KRAB-associated protein 1 GTGCAGGGAG (SEQ ID NO: 14) 18/2 AF071538 PDEF, ets transcription factor GACAAACATT (SEQ ID NO: 15) 8/1 NM_003201 mtTF1, mitochondrial transcription factor 1 ATGACTCAAG (SEQ ID NO: 16) 8/1 X12794 ear-2, v-erbA related GAAAAGAAGG (SEQ ID NO: 17) 8/1 U80669 Nkx3.1, homeobox CCTGTACCCC (SEQ ID NO: 18) 5/1 AF072836 Sox-like transcriptional factor CCTGAACTGG (SEQ ID NO: 19) 1/8 NM_001273 CHD4/Mi2-beta, histone acetylase/deacetylase, chromodomain helicase TGACAGCCCA (SEQ ID NO: 20) 1/7 U81599 Hox B13, homeobox RNA Processing and Translational Regulators TACAAAACCA (SEQ ID NO: 21) 12/1 NM_005381 NCL, Nucleolin AATTCTCCTA (SEQ ID NO: 22) 8/1 U41387 GURDB, nucleolar RNA helicase TGCATATCAT (SEQ ID NO: 23) 8/1 D89729 XPOl, exportin 1 CTTGACACAC (SEQ ID NO: 24) 14/2 AL080102 EIF5, translation initiation factor 5 TGTCTAACTA (SEQ ID NO: 25) 5/1 AF078865 CGI-79, RNA-binding protein GTGGACCCCA (SEQ ID NO: 26) 10/2 AF190744 SiahBP1/PUF60, poly-U binding splicing factor ATAAAGTAAC (SEQ ID NO: 27) 1/11 NM_007178 UNRIP, unr-interacting protein. TACATTTTCA (SEQ ID NO: 28) 1/7 X85373 SNRPG, small nuclear RNP polypeptide G TCAGAACAGT (SEQ ID NO: 29) 1/7 NM_002092 GRSF-1, G-rich RNA binding factor 1 CAACTTCAAC (SEQ ID NO: 30) 0/5 NM_006451 PAIP1, poly A BP-interactimg protein 1 GATAGGTCGG (SEQ ID NO: 31) 0/5 Z11559 IREBP1, Iron-responsive element BP 1 CTAAAAGGAG (SEQ ID NO: 32) 2/10 M15919 SNRPE, small nuclear RNP polypeptide E Genomic Maintenance and Cell Cycle Regulation GTGGTGCGTG (SEQ ID NO: 33) 10/1 AF035587 XRCC2, X-ray repair protein 2 TCCCCGTGGC (SEQ ID NO: 34) 7/1 D13643 KIAA0018, Dimunuto-like ATTGATCTTG (SEQ ID NO: 35) 6/1 NM_002947 RPA3, Replication protein A 14 kDa subunit AGCTGGTTTC (SEQ ID NO: 36) 16/3 NM_004879 PIG8, p53 induced protein CCTCCCCCGT (SEQ ID NO: 37) 10/2 AF044773 BAF, barrier-to-autointegration factor ATGTACTCTG (SEQ ID NO: 38) 1/7 NM_000884 IMPDH2, IMP dehydrogenase 2 GATGAAATAC (SEQ ID NO: 39) 0/5 NM_006325 ARA24, androgen receptor assoc protein 24 GTGCATCCCG (SEQ ID NO: 40) 0/5 X16312 Phosvitin/casein kinase II beta subunit Protein Trafficking and Chaperoning GAAATTAGGG (SEQ ID NO: 41) 12/1 AB020637 KIAA0830, similar to golgi antigen TTTCTAGGGG (SEQ ID NO: 42) 10/1 AF15189 CGI-140, lysosomal alpha B mannosidase CCCAGGGAGA (SEQ ID NO: 43) 7/1 AF026291 CCT, chaperomin t-complex polypeptide 1 GTGGCGCACA (SEQ ID NO: 44) 13/2 S79862 26 S protease subunit 5b TTGCTTTTGT (SEQ ID NO: 45) 15/3 NM_001660 ARF4, ADP-ribosylation factor 4 ATGTCCTTTC (SEQ ID NO: 46) 10/2 NM_005570 LMAN1, mannose BP involved in EPR/Golgi traffic Energy Metabolism, Apoptosis and Redox Regulators TGTTTATCCT (SEQ ID NO: 47) 13/2 M14200 DBI, diazepam binding inhibitor GCTTTGTATC (SEQ ID NO: 48) 6/1 D16373 dihydrolipoamide succinyltransferase GTTCCAGTGA (SEQ ID NO: 49) 6/1 AA653318 FKBP5, FK506-binding protein 5 TAGCAGAGGC (SEQ ID NO: 50) 6/1 AA425929 NDUFB10, NADH dehydrogenase 1 beta subcomplex 10 ACAAATTATG (SEQ ID NO: 51) 5/1 NM_003375 VDAC, voltage-dependent anion channel CAGTTTGTAC (SEQ ID NO: 52) 5/1 NM_000284 PDHA1, Pyruvate dehydrogenase El-alpha subunit GATTACTTGC (SEQ ID NO: 53) 5/1 NM_004813 PEX16, peroxisomal membrane biogenesis factor GGCCAGCCCT (SEQ ID NO: 54) 5/1 X15573 PFKL, 1-phosphofructokinase CAATTGTAAA (SEQ ID NO: 55) 1/10 NM_004786 TXNL, thioredoxin-like protein AAAGCCAAGA (SEQ ID NO: 56) 2/15 NM_001985 ETFB, electron transfer flavoprotein beta subunit CAACTAATTC (SEQ ID NO: 57) 1/7 NM_001831 CLU, Clustrin AAGAGCTAAT (SEQ ID NO: 58) 0/5 NM_004446 EPRS, glutamyl-prolyl-tRNA synthetase Signal Transduction CTTTTCAAGA (SEQ ID NO: 59) 9/1 X59408 CD46, complement system membrane cofactor GTGTGTAAAA (SEQ ID NO: 60) 9/1 NM_005745 BAP31/BAP29 IgD accessory proteins ACAAAATGTA (SEQ ID NO: 61) 8/1 NM_000856 GUCY1A3, Guanylate cyclase 1, alpha 3 AAGGTAGCAG (SEQ ID NO: 62) 7/1 NM_006367 CAP, Adenylyl cyclase-associated protein GGCGGGGCCA (SEQ ID NO: 63) 7/1 AB002301 microtubule assoc. serine/threonine kinase GGCCAGTAAC (SEQ ID NO: 64) 6/1 AL096857 similar to HAT2, integrin receptor AACTTAAGAG (SEQ ID NO: 65) 12/2 AB018330 calmodulin-dependent protein kinase kinase β AGGGATGGCC (SEQ ID NO: 66) 5/1 NM_006858 IL1RL1LG, Putative T1/ST2 receptor CTTAAGGATT (SEQ ID NO: 67) 2/10 AF151813 CGI-55 protein - The “tag to gene” identification is based on the analysis performed by SAGE software and/or “tag to gene” application of the NIH SAGE Website. T/C represent the number of tags for each transcript in androgen treated (T) and control (C) LNCaP libraries. The differences in expression levels of genes identified by tags shown here were statistically significant (p<0.05) as determined by the SAGE software.
- 1. Landis S H, Murray T, Bolden S, and Wingo P A: Cancer statistics. CA Cancer J. Clin., 49:8-31, 1999.
- 2. Pannek J and Partin A W: Prostate-specific Antigen: What is new in 1977. Oncology 11, 1273-1282, 1997.
- 3. Small E J: Update on the diagnosis and treatment of prostate cancer: Curr. Opin. Oncol., 10:244-252, 1998.
- 4. Krongrad A, Lai H, and Lai S: Survival after radical prostatectomy. JAMA, 278:44-46, 1997.
- 5. Garwick, M B and Fair W R: Prostate Cancer, Scientific American, 75-83, 1998.
- 6. Augustus M, Moul J W, and Srivastava S: The molecular phenotype of the malignant prostate. Molecular pathology of early cancer (in press), 1999.
- 7. Sakr W A, Macoska J A, Benson P, Benson D J, Wolman S R, Pontes J E, and Crissman: Allelic loss in locally metastatic, multi-sampled prostate cancer. Cancer Res., 54:3273-3277, 1994.
- 8. Mirchandani D, Zheng J, Miller G L, Ghosh A K, Shibata D K, Cote R J and Roy-Burman P: Heterogeneity in intratumor distribution of p53 mutations in human prostate cancer. Am. J. Path. 147:92-101, 1995.
- 9. Bauer J J, Moul J W, and McLeod D G: CaP: Diagnosis, treatment, and experience at one tertiary medical center, 1989-1994. Military Medicine, 161:646-653,1996.
- 10. Moul J W, Gaddipati J, and Srivastava S: 1994. Molecular biology of CaP. Oncogenes and tumor suppressor genes. Current Clinical Oncology: CaP. (Eds. Dawson, N. A. and Vogelzang, N. J.), Wiley-Liss Publications, 19-46.
- 11. Lalani E-N, Laniado M E and Abel P D: Molecular and cellular biology of prostate cancer. Cancer and Mets. Rev., 16:29-66, 1997.
- 12. Shi X B, Gumerlock P H, deVere White R W: Molecular Biology of CaP. World J. Urol; 14, 318-328, 1996.
- 13. Heidenberg H B, Bauer J J, McLeod D G, Moul J W and Srivastava S: The role of p53 tumor suppressor gene in CaP: a possible biomarker? Urology, 48:971-979, 1996.
- 14. Bova G S and Issacs W B: Review of allelic loss and gain in prostate cancer. World J Urol., 14:338-346, 1996.
- 15. Issacs W B and Bova G S: Prostate Cancer: The Genetic Basis of Human Cancer. Eds. Vogelstein B, and Kinzler K W, McGraw-Hill Companies, Inc., pp. 653-660, 1998.
- 16. Heidenberg H B, Sesterhenn I A, Gaddipati J, Weghorst C M, Buzard G S, Moul J W, and Srivastava S: Alterations of the tumor suppressor gene p53 in a high fraction of treatment resistant prostate cancer. J. Urol., 154:414-421, 1995.
- 17: Bauer J J, Sesterhenn I A, Mostofi F K, McLeod D G, Srivastava S, Moul J W: p53 protein expression is an independent prognostic marker in clinically localized prostate cancer patients. Clin. CancerRes., 1:1295-1300, 1995.
- 18. Bauer J J, Sesterhenn I A, Mostofi F K, McLeod D G, Srivastava S, Moul, J W: Elevated levels of apoptosis regulator proteins p53 and bcl-2 are independent prognostic biomarkers in surgically treated clinically localized prostate cancer patients. J. Urol., 1511-1516, 1996.
- 19. Yang G, Stapleton A M, Wheeler T M, Truong L D, Timme T O; Scardino T P, and Thompson T O: Clustered p53 immunostaining. A novel pattern associated with prostate cancer progression. Clin. Cancer Res., 2:399-401, 1996.
- 20. Cairns P, Okami K, Halachmi S, Halachmi N, Esteller M, Herman J G, Jen J, Isaacs W B, Bova G S, and Sidransky D: Frequent inactivation of PTEN/MMAC1 in primary prostate cancer Cancer Res, 57:4997-5000, 1997.
- 21. Suzuki H, Freije D, Nusskern D R, Okami K, Cairns P, Sidransky D, Isaacs W B, and Bova G S: Interfocal heterogeneity of PTEN/MMAC1 gene alterations in multiple metastatic prostate cancer tissues: Cancer Res, 58:204-209, 1998.
- 22. Jenkins R B, Qian J, Lieber M M and Bostwick D G: Detection of c-myc oncogene amplification and chromosomal abnormalities in metastatic prostatic carcinoma by fluorescence in situ hybridization. Cancer Res, 57:524-531, 1997.
- 23. Reiter R E, Gu Z, Watabe T., Thomas G, Szigeti K, Davis E, Wahl M, Nisitani S, Yamashiro I, LeBeau M M, Loda M and Witte O N: Prostate stem cell antigen: a cell surface marker overexpressed in prostate cancer. Proc Natl Acad Sci, 95:1735-40, 1998.
- 24. Visakorpi T, Kallioniemi A H, Syvanen A, Hyytinen E R, Karhu R, Tammela T, Isola J J and Kallioniemi O-P: Genetic changes in primary and recurrent prostate cancer. Cancer Res. 55:342-347, 1995.
- 25. Cher M L, Bova G S, Moore D H, Small E J, Carroll P A, Pinn S S, Epstein J L, Isaacs W B and Jensen R H: Genetic alterations in untreated metastases and androgen-independent prostate cancer detected by comparative genomic hybridization and allotyping. Cancer Res, 56:3091-3102, 1996.
- 26. Srikantan V, Sesterhenn I A, David L, Hankins G R, Avallone F A, Livezey J R, Connelly R, Mostofi F K, McLeod D G, Moul J W, Chandrasekharappa, SC, and Srivastava S: Chromosome 6q alterations in human prostate cancers. Int J Cancer (in press), 1999.
- 27. Smith J R, Freije D, Carpten J D, Gronberg H, et al: Major susceptibility locus for prostate cancer on chromosome I suggested by a genome-wide search. Science, 276:1371-1374, 1996.
- 28. Xu J, Meyers D, Freije D, Issacs S, et al: Evidence for a prostate cancer susceptibility locus on x chromosome. Nat. Genet, 20: 175-179, 1998.
- 29. Liang, Peng, and Pardee A B: Differential display of eukaryotic messenger RNA by means of the polymerase chain reaction. Science 257:967-971, 1992.
- 30. Velculescu V E, Zhang L, Vogelstein B, and Kinzler K W: Serial analysis of gene expression Science, 270:484-487, 1995.
- 31. Chena M, Shalon D S, Davis R W, and Brown P O: Quantitative monitoring of gene expression patterns with a complementary DNA microarrays. Science, 270:467-470, 1995.
- 32. Srikantan V., Zou Z, Davis L D, Livezey J, Sesterhenn I A, Xu L, Mostofi F K, McLeod DG, Moul J W, and Srivastava S: Structure and expression of a novel prostate specific gene PCGEM1. American Assoc. Cancer Res. Meeting, Philadelphia, Pa., 1999.
- 33. Xu, L, Su Y, Labiche R, McLeod D G, Moul J W and Srivastava S: Probing the androgen regulated genes (ARGs) in prostate cancer cells by serial analysis of gene expression (SAGE). American Assoc. of Cancer Research Meeting, 1999.
- 34. Huggins, C., Hodges, C.V. Studies on prostate cancer, effects of castration, of estrogens and androgen injection on serum phosphatase in metastatic carcinoma of the prostate. Cancer Res, 1:293-297, 1941.
- 35. Moul J W: Contemporary hormonal management of advanced prostate cancer. Oncology, 12: 499-505, 1998.
- 36. Veldscholte, J, R is-Stalpers C, Kulper G G J M, Jenster G, Berre-voets C, Classen E, Van Roooj H C J, Trapman J, Brinkmann A O, Mulder E. A mutation in the ligand binding domain of the androgen receptor of human LNCaP cells affects steroid binding characteristics and response to anti-androgens. Biochem. Biophys. Res. Commun., 173:534-540, 1990.
- 37. Newmark J R, Hardy O, Tonb D C, Carter BS, Epstein J I, Isaacs W B, Brown T R, Barrack ER. Androgen receptor gene mutations in human prostate cancer. Proc Natl Acad Sci USA, 89:6319-6323, 1992.
- 38. Culig Z, Hobisch A, Cronauer M V, Cato A C B, Hittmair A, Radmayr C, Eberie J, Bartsch G, Klocker H. Mutant androgen receptor detected in an advanced stage prostatic carcinoma is al activated by adrenal androgens and progesterone. Mol. Endocrinol, 7:1541-1550, 1993.
- 39. Suzuki H, Sato N, Watabe Y, Masai M, Seino S, Shimazaki S. Androgen receptor gene mutations in human prostate cancer. J Steroid Biochem Mol Biol, 46:759-765, 1993.
- 40. Gaddipatti J P, McLeod D G, heidenberg H B, Sesterhann I A, Finger M J, Moul J W, Srivastava S. Frequent detection of codon 877 mutation in the androgen receptor gene in advanced prostate cancers. Cancer Res, 54:2861-2864.1994.
- 41. Peterziel H, Culig Z, Stober J, Hobisch A, Radmayr C, Bartsch G, Klocker, Cato A C B. Mutant androgen receptors in prostate cancer distinguish between amino acid sequence requirements for transactivation and ligand binding. Int J Cancer, 63:544-550, 1995.
- 42. Taplin M-E, Bubley G J, Shuster T D, Frantz M E, Spooner A E, Ogata G K, Keer H N, Balk S P. Mutation of the androgen receptor gene in metastatic androgen independent prostate cancer. N Engl J Med, 332:1393-1398.
- 43. Tilley W D, Buchanan G, Hickey T E, Bental J M. Mutation in the androgen receptor gene are associated with progression of human prostate cancer to androgen independence. Clin Cancer Res, 2: 277-285, 1994.
- 44. Visakorpi T, Hyytinen E, Koivisto P, tanner M, Keinanen R, Palmberg C, Tarnmela T, Isola J, Kallioniemi O P. In vivo amplification of the androgen receptor gene and progression of human prostate cancer. Nature Genet, 9:401-406, 1995.
- 45. Koivisto P, Kononen J, Palmberg C, Tamniela T, Hyytinen E, Isola J, Trapman J, Cleutjens K, Noordzij A, Visakorpi T, Kallioniemi O P. Androgen receptor gene amplification: a possible molecular mechanism for androgen deprivation therapy failure in prostate cancer. Cancer Res, 57:314-318, 1997.
- 46. Culig Z, Hobisch A, Cronauer M V, Radmayr C, Trapman J, Hittmair A, Bartsch G, Klocker H. Androgen receptor activation in prostate tumor cell lines by insulin-like growth factor-1, keratinocyte growth factor, and epidermal growth factor. Cancer Res, 54:5474-5478, 1994.
- 47. Yeh S, Chang C. Cloning and characterization of a specific coactivator, ARA70, for the androgen recptor in human prostate cells. Proc Natl Acad Sci USA, 93:5517-5521, 1996.
- 48. Nagabhushan M, Miller C M, Pretlow T P, Giaconia J M, Edgehouse N L, Schwartz S, Kung H-J, deVere White R W, Gumerlock P H, Resnick M I, Amini S B, Pretlow T G. CWR22: The first human prostate cancer Xenograft with strongly androgen-independent and relapsed strains both in vivo and in soft agar. Cancer Res, 56:3402-4306, 1996.
- 49. Gregory C W, Hamil K G, Kim D, Hatt S H, Pretlow T G, Mohler J L, French F S. Androgen receptor expression in androgen independent cancer is associated with increased expression of androgen regulated genes. Cancer Res, 58:5718-5724, 1998.
- 50. Noble R L: The development of prostatic adenocarcinoma in Nb rats following prolonged sex hormone administration. Cancer Res, 37:1929-1933, 1977.
- 51. Pollard M: Lobund-Wistar rat model of prostate cancer in man. Prostate, 37:1-4, 1998.
- 52. Pollard M, Luckert P H, and Snyder D L: The promotional effect of testosterone on induction of prostate cancer in MNU-sensitized L-W rats. Cancer Lett, 45:209-212, 1989.
- 53. Gann P H, Hennekens C H, Ma J, Longcope C, Stampfer M J: Prospective study of sex hormone levels and risk of prostate cancer J Natl Cancer Inst, 88:1118-1126, 1996.
- 54. Hakimi J M, Schoenberg M P, Rondinelli R H, Piantadosi S, Barrack E R. Androgen receptor variants with short glutamine or glycine repeats may identify unique subpopulations of men with prostate cancer. Clin Cancer Res, 9:1599-1608, 1997.
- 55. Giovanucci E, Stampfer M J, Krithivas K, Brown M, Brafsky A, Talcott J, Hennekens C H, Kantoff P W. The CAG repeat within the androgen receptor gene and its relationship to prostate cancer. Proc Natl Acad Sci USA, 94:3420-3423, 1997.
- 56. Coetzee G A, Ross R K. Prostate cancer and the androgen receptor. J. Natl Cancer Inst ,86:872-873, 1994.
- 57. Moul J W. Increased risk of prostate cancer in African men. Mol. Urol, 1: 119-127, 1997.
- 58. Chamberlain N L, Driver E D, Miesfeld R L. The length and location of CAG trinucleotide repeats in the androgen receptor N-terminal domain affect transactivation function. Nucleic Acids Res, 22:3181-3186, 1994.
- 59. Trapman J, Cleutzens K B J M. Androgen regulated gene expression in prostate cancer. Seminars in Canc Biol, 8:29-36, 1997.
- 60. Yuan S, Trachtenberg J, Mills G B, Brown T J, and Keating A: Androgen-induced inhibition of cell proliferation in an androgen-insensitive prostate cancer cell line (PC3) transfected with human androgen receptor complementary DNA. Cancer Res,53:1304-1311, 1993.
- 61. Velculescu V E, Zhang L, Vogelstein B, and Kinzler K W: Serial Analysis of Gene Expression. Science, 270, 484-487, 1995
- 62. Polyak K, Yong X, Zweier J L, Kinzler K W, and Vogelstein B: A model for p53 induced apoptosis. Nature, 389, 300-306, 1997.
- 63. Hermeking H, Lengauer C, Polyak C, He T-C, Zhang L, Thiagalingam S, Kinzler K W, and Vogelstein B: 14-3-3 is a p53-regulated inhibitor of G2/M progression. Molecular Cell, 1: 3-11, 1997.
- 64. He T-C, Sparks A B, Rago C, Hermeking H, Zawel L, da Costa L T, Morin P J, Vogelstein B, and Kinzler K W: Identification of c-myc as a target of the APC pathway. Science,281;1438-1441, 1998.
- 65. Bieberich, C. J., Fujita, K., He, W. W., and Jay, G.: Prostate-specific and androgen-dependent expression of a novel homeobox gene. J Biol Chem, 271: 31779-31782, 1996.
- 66. Sciavolino, P. J., Abrams, E. W., Yang, L., Austenberg, L. P., Shen, M. M., and Abate-Shen, C.: Tissue-specific expression of murine Nkx3.1 in the male urogenital sinus. Dev Dyn, 209: 127-138, 1997.
- 67. He, W. W., Sciavolino, P. J., Wing, J., Augustus, M., Hudson, P., Meissner, S. P., Curtis, R. T., Shell, B. K., Bostwick, D. G., Tindall, D. J., Gelmann, E. P., Abate-Shen, C., and Carter, K. C.: A novel human prostate-specific androgen-regulated homeobox gene (NKX3.1) that maps to 8p21, a region frequently deleted in prostate cancer. Genomics, 43: 69-77, 1997.
- 68. Prescott J. L., Blok L., and Tindall D. J.: Isolation and androgen regulation of the human homeobox cDNA, NKX3.1. The Prostate, 35: 71-80, 1998.
- 69. Xu L, Srikantan V, Sesterhenn I A, Augustus M, Sui D, Moul J W, Carter K C and Srivastava S: Evaluation of expression of androgen regulated prostate specific homeobox gene, NKX3.1 in human prostate cancer. Int. Symp. on Biol. of Prostate Growth, Bethesda, 176, 1998; Manuscript submitted to J Urol, 1999.
- 70. Voelier, H. J, Augustus, M, Madike, V., Bova, G. S., Carter, K. C., and Gelmann. E. P.: Coding region of NKX3.1, a prostate-specific homeobox gene on 8p21, is not mutated in human prostate cancers. Cancer Res, 57: 4455-4459, 1997.
- 71. Song, K., Wang, Y., and Sassoon, D.: Expression of Hox-7.1 in myoblasts inhibits terminal differentiation and induces cell transformation. Nature, 360: 477-481, 1992.
- 72. Maulbecker, C. C., and Gruss, P.: The oncogenic potential of deregulated homeobox genes. Cell Growth Differ, 4: 431-441, 1993.
- 73. Krosl, J., Baban, S., Krosl, G., Rozenfeld, S., Largman, C., and Sauvageau, G.: Cellular proliferation and transformation induced by HOXB4 and HOXB3 proteins involves cooperation with PBX1. Oncogene, 16: 3403-3412, 1998.
- 74. Kaighn M E, Reddel R R, Lechner J F, Peehl D M, Camalier R F, Brash D E, Saffioti U, and Harris C C: Transformation of human neonatal prostate epithelial cells strontium phosphate transfection with plasmid containing SV40 early region genes. Cancer Res, 49: 3050-3056, 1989.
- 75. Kuettel M R, Thraves P J, Jung M, Varghese S P, Prasad S C, Rhim J S, and Dritschilo A: Radiation-induced neoplastic transformation of human prostate epithelial cells. Cancer Res, 156:5-10, 1996.
- 76. Srivastava S, Wheelock R H P, Eva A, and Aaronson S A: Identification of the protein encoded by novel human diffuse B cell lymphoma oncogene. Proc Natl Acad Sci, USA, 83:8868-8872, 1986.
- 77. Graziani G, Ron D, Eva A, and Srivastava: The human db1 proto-oncogene product is a cytoplasmic phosphoprotein which is associated with cytoskeletal matrix. Oncogene, 4:823-829, 1989.
- 78. Srivastava S, Zou Z, Pirollo K, Blattner W, and Chang E S: Germ-line transmission of a mutated p53 gene in a cancer-prone family with Li-Fraumeni syndrome. Nature, 348:747-749, 1990.
- 79. Srivastava, S., Wang, S., Tong, Y. A., Hao, Z. M. and Chang, E. H.: Dominant negative effect of a germ-line mutant p53: a step fostering tumorigenesis. Cancer Res, 53:4452, 1993.
- 80. Gaddipati J P, Mcleod D G, Sesterhenn I A, Hussussian C J, Tong Y A, Seth P. Dracopoli N C, Moul J M, and Srivastava, S: Mutations of p16 gene are rare in prostate cancer. Prostate. 30:188-194, 1997.
- 81. Bonner R F, Emmert-Buck M, Cole K, Pohida T, Chuaqi R, Goldstein S, and Liotta L A: Laser capture microdissection: molecular analysis of tissue. Science, 278:1481-1483, 1997.
- Bastian, B. C., Le Boit, P. E., Hamm, H., Brocker, E. B., and Pinkel, D. (1998). Chromosomal gains and losses in primary cutaneous melanomas detected by comparative genomic hybridization. Cancer Res. 58: 2170-2175.
- Bentel, J. M., Tilley, W. D. (1996). Androgen receptors in prostate cancer.J. Endocrinology 151: 1:-1.
- Brothman, A. R., Peehl, D. M., Patel, A. M., and McNeal, J. E. (1990). Frequency and pattern of karyotypic abnormalities in human prostate cancer.Cancer Res. 50: 3795-3803.
- Cuthill, S. (1999). Dominant genetic alterations in immortalization: Role for 20q gain.Genes Chromosomes Cancer 26: 304-311.
- Gregory, C. W., Hamil, K. G., Kim, D., Hall, S. H., Pretlow, T. G., Mohler, J. L., and French, F. S. (1998). Androgen receptor expression in androgen-independent prostate cancer is associated with increased expression of androgen-regulated genes.Cancer Res. 58: 5718-5724.
- Jarrard, D. F., Sarkar, S., Shi, T., Teager, T. R., Magrane, G., Kinoshita, H., Nassif, N., Meisner, L., Newton, M. A., and Waldman, F. M. (1999). p16/pRb pathway alterations are required for bypassing senescence in human prostate epithelial cells.Cancer Res. 59: 2957-2964.
- Jenster G. (1999). The role of the androgen receptor in the development and progression of prostate cancer.Semin. Oncol. 26: 407-421.
- Koivisto, P., Kolmer, M., Visakorpi, T., and Kallioniemi O. P. (1996). Androgen receptor gene and hormonal therapy failure of prostate cancer.Am. J. Pathol. 152: 1-9.
- Korn, W. M., Yasutake, T., Kuo, W. L., Warren, R. S., Collins, C., Tomita, M., Gray, J., and Waldman, F. M. (1999). Chromosome arm 20q gains and other genomic alterations in colorectal cancer metastatic to liver, as analyzed by comparative genomic hybridization and fluorescence in situ hybridization.Genes Chromosomes Cancer. 25: 82-90.
- Lin, B., Ferguson, C., White, J. T., Wang, S., Vessella, R., True, L. D., Hood, L., and Nelson, P. (1999). Prostate-localized and androgen-regulated expression of the membrane-bound serine proteaseTMPRSS2. Cancer Res. 59: 4180-4184.
- Mahlamaki, E. H., Hoglund, M., Gorunova, L., Karhu, R., Dawiskiba, S., Andren-Sandberg, A., Kallioniemi, P. P., and Johansson, B. (1997). Comparative genomic hybridization reveals frequent gains of 20q, 8q, 1 q, 12p, and 17q, and losses of 18q, 9p, and 15q in pancreatic cancer.Genes Chromosomes Cancer. 24: 383-391.
- Moul J. W. (1998). Contemporary hormonal management of advanced prostate cancer. Oncology, 12: 499-505.
- Nagabhushan, M., Miller, C. M., Pretlow, T. P., Ciacomia, J. M., Edgehouse, N. L., Schwarts, S., Kung, H., White, R. W., Gumerlock, P. H., Resnick, M. I., Amini, S. B., and Pretlow, T. G. (1996). CW 2: the first human prostate cancer xenograft with strongly androgen-dependent and relapsed strains both in vivo and in soft agar.Cancer Res. 56: 3042-3046.
- Richter, J., Beffa, L., Wagner, U., Schraml, P., Gasser, T. C., Moch, H., Mihatsch, M. J., and Sauter, G. (1998). Patterns of chromosomal imbalances in advanced urinary bladder cancer detected by comparative genomic hybridization.Am. J. Pathol. 153: 1615-1621.
- Stubbs, A. P., Abel, P. D., Golding, M., Bhangal, G., Wang, Q., Waxman, J., Stamp, G. W., and Lalani, E. N. (1999). Differentially expressed genes in hormone refractory prostate cancer: association with chromosomal regions involved with genetic aberrations.Am. J. Pathol. 154: 1335-1343.
- Tanner, M. M., Tirkkonen, M., Kallioniemi, A., Isola, J., Kuukasjarvi, T., Collins, C., Kowbel, D., Guan, X. Y., Trent, J., and Gray, J. W. (1996). Independent amplification and frequent co-amplification of three nonsyntenic regions on the long arm of chromosome 20 in human breast cancer.Cancer Res. 56: 3441-3445.
- Zhang, L., Zhou, W., Velculescu, V. E., Kern, S. E., Hruban, R. H., Hamilton, S. R., Vogelstein, B., And Kinzler, K. W. (1997). Gene expression profiles in normal and cancer cells.Science, 276: 1268-1272.
- Douarin, B. L., You, J., Nielsen, A. L., Chambon, P., and Losson, R., Tif1α: a possible link between KRAB zinc finger proteins and nuclear receptors. J. Steroid Biochem. Molec. Biol., 65, 43-50 (1998).
- Xu, L., Su, Y., Labiche, R., Mcleod, D. G., Moul, J. W., and Srivastava, S., Quantitative Evaluation of the Expression Profile of the Androgen Regulated Genes (ARGs) in Prostate Cancer Cells. AACR annual meeting (1999).
- Xu, L., Glass, C. K., and Rosenfeld, M. G., Coactivator and corepressor complexes in nuclear receptor function. Curr. Opin. Genet. Dev., 9, 140-147 (1999).
- Miyajima, N., Kadowaki, Y., Fukushige, S., Shimizu, S., Semba, K., Yamanashi, Y., Matsubara, K., Toyoshima, K., and Yamamoto, T., Identification of two novel members of erbA superfamily by molecular cloning: the gene products of the two are highly related to each other. Nucleic Acids Res., 16, 11057-11074 (1998).
- Sreenath, T., Orosz, A., Fujita, K., and Bieberich, C. J., Androgen-independent expression of hoxb-13 in the mouse prostate. Prostate, 41, 203-207 (1999).
- Patel, M. S., and Harris, R. A., Mammalian alpha-keto acid dehydrogenase complexes: gene regulation and genetic defects. FASEB J., 9, 1164-1172 (1995).
- Ho, L., Wexler, I. D., Liu, T. C., Thekkumkara, T. J., and Patel, M. S., Characterization of cDNAs encoding human pyruvate dehydrogenase alpha subunit. Proc. Nat. Acad. Sci., 86, 5330-5334 (1989).
- Ton, C., Hwang, D. M., Dempsey, A. A., and Liew, C. C., Identification and primary structure of five human NADH-ubiquinone oxidoreductase subunits. Biochem. Biophys. Res. Commun., 241, 589-594 (1997).
- Blachly-Dyson, E., Baldini, A., Litt, M., Mccabe, E. R. B., and Forte, M., Human genes encoding the voltage-dependent anion channel (VDAC) of the outer mitochondrial membrane: mapping and identification of two new isoforms. Genomics, 20, 62-67 (1994).
- Swinnen, J. V., Vercaeren, I., Esquenet, M., Heyns, W., and Verhoeven, G., Androgen regulation of the messenger RNA encoding diazepam-binding inhibitor/acyl-CoA-binding protein in the rat. Mol. Cell Endocrinol., 118, 65-70 (1996).
- Knudsen, J., Mandrup, S., Rasmussen, J. T., Andreasen, P. H., Poulsen, F., and Kristiansen, K., The function of acyl-CoA-binding protein (ACBP)/diazepam binding inhibitor (DBI). Mol. Cell Biochem., 123, 129-138 (1993).
- Miranda-Vizuete, A., Gustafsson, J. A., and Spyrou, G., Molecular cloning and expression of a cDNA encoding a human thioredoxin-like protein. Biochem. Biophys. Res. Commun., 243, 284-288 (1998).
- Cartwright, R., Tambini, C. E., Simpson, P. J., and Thacker, J., The XRCC2 DNA repair gene from human and mouse encodes a novel member of the recA/RAD51 family. Nucleic Acids Res., 26, 3084-3089 (1998).
- Umbricht, C. B., Lrdile, L. F., Jabs, E. W., and Kelly, T. J., Cloning, overexpression, and genomic mapping of the 14-kDa subunit of human replication protein A. J. Biol. Chem., 268, 6131-6138 (1993).
- Gu, Z., Flemington, C., Chittenden, T., and Zambetti, G. P., ei24, a p53 response gene involved in growth suppression and apoptosis. Mol. Cell. Biol., 20, 233-241 (2000).
- Srivastava, M., and Pollard, H. B., Molecular dissection of nucleolin's role in growth and cell proliferation: new insights. FASEB J., 13, 1911-1922 (1999).
- Page-Mccaw, P. S., Arnonlirdviman, K., and Sharp, P.A., Puf60: A U2AF65 homolog that binds the pyrimidine tract. RNA, 5, 1548-1560 (1999).
- Qian, Z., and Wilusz, J., Grsf-1: a poly (A)+mRNA binding protein which interacts with a conserved G-rich element. Nucleic Acids Res., 22, 2334-2343 (1994).
- Craig, A. W., Haghighat, A., Yu, A. T., and Sonenberg, N., Interaction of polyadenylate-binding protein with the eIF4G homologue PAIP enhances translation. Nature, 392, 520-523 (1998).
- Hunt, S. L., Hsuan, J. J., Totty, N., and Jackson, R. J., unr, a cellular cytoplasmic RNA-binding protein with five cold-shock domains, is required for internal initiation of translation of human rhinovirus RNA. Genes Dev., 13, 437-448 (1999).
- Velculescu, V. E., Zhang, L., Zhou, W., Vogelstein, J., Basrai, M. A., Bassett, D. E. Jr., Hieter, P., Vogelstein, B., and Kinzier, K. W., Characterization of the yeast transcriptome. Cell, 88, 243-251 (1997).
- Polyak, K., Xia, Y., Zweier, J. L., Kinzler, K. W., and Vogelstein, B., A model for p53induced apoptosis. Nature, 389, 300-305 (1997).
- Henneking, H., Lengauer, C., Polyak, K., He, T. C., Zhang, L., Thiagalingam, S., Kinzler, K. W., and Vogelstein, B. 14-3-3-a is a p53-regulated inhibitor of G2/M progression. Molecular Cell, 1, 3-11 (1997).
- Korinek, V., Barker, N., Morin, P. J., Wichen, D., Weger, R., Kinzler, K. W., Vogelstein, B., and Clevers, H., Constitutive transcriptional activation by a β-Catenin-Tcf complex in APC colon carcinoma. Science, 275, 1784-1787 (1997).
- Zhang, L., Zhou, W., Velculescu, V. E., Kern, S. E., Hruban, R. H., Hamilton, S. R., Vogelstein, B., and Kinzler, K. W., Gene expression profiles in normal and cancer cells. Science, 276, 1268-1272 (1997).
- Hibi, K., Liu, Q., Beaudry, G. A., Madden, Sl., Westra, W. H., Wehage, S. L., Yang, S. C., Heitmiller, R. F., Bertelsen, A. H., Sidransky, D., and Jen, J. Serial analysis of gene expression in non-small cell lung cancer. Cancer Res., 58, 5690-5694 (1998).
- Nacht, M., Ferguson, A. T., Zhang, W., Petroziello, J. M., Cook, B. P., Gao, Y. H., Maguire, S., Riley, D., Coppola, G., Landes, G. M., Madden, S. L., and Sukumar, S., Combining serial analysis of gene expression and array technologies to identify genes differentially expressed in breast cancer. Cancer Res., 59, 5464-5470 (1999).
- Waard, V., Berg, B. M. M., Veken, J., Schultz-Heienbrok, R., Pannekoek, H., and Zonneveld, A., Serial analysis of gene expression to asssess the endothelial cell response to an atherogenic stimulus. Gene, 226, 1-8 (1999).
- Berg, A., Visser, L., and Poppema, S., High expression of the CC chemokine TARC in reed-stemberg cells. A possible explanation for the characteristic T-cell infiltrate in hodgkin' lymphoma. Am. J. Pathol., 154, 1685-1691 (1999).
- Iyer, V. R., Eisen, M. B., Ross, D. T., Schuler, G., Moore, T., Lee, J. C. F., Trent, J. M., Staudt, L. M., Hudson, J. Jr., Boguski, M. S., Lashkari, D., Shalon, D., Botstein, D., and Brown, P. O., The trancriptional program in the response of human fibroblasts to serum. Science, 283, 83-87 (1999).
- Charpentier, A. H., Bednarek, A. K., Daniel, R. L., Hawkins, K. A., Laflin, K. J., Gaddis, S., Macleod, M. C., and Aldaz, C. M., Effects of estrogen on global gene expression: identification of novel targets of estrogen action. Cancer Res., 60, 5977-5983 (2000).
- Ripple, M. O., Henry, W. F., Rago, R. P., and Wilding, G., Prooxidant-antioxidant shift induced by androgen treatment of human prostate carcinoma cells. J. Nat. Cancer Inst., 89, 40-48 (1997).
-
-
1 67 1 1140 DNA Homo sapiens CDS (95)..(850) 1 tccttgggtt cgggtgaaag cgcctggggg ttcgtggcca tgatccccga gctgctggag 60 aactgaaggc ggacagtctc ctgcgaaaca ggca atg gcg gag ctg gag ttt gtt 115 Met Ala Glu Leu Glu Phe Val 1 5 cag atc atc atc atc gtg gtg gtg atg atg gtg atg gtg gtg gtg atc 163 Gln Ile Ile Ile Ile Val Val Val Met Met Val Met Val Val Val Ile 10 15 20 acg tgc ctg ctg agc cac tac aag ctg tct gca cgg tcc ttc atc agc 211 Thr Cys Leu Leu Ser His Tyr Lys Leu Ser Ala Arg Ser Phe Ile Ser 25 30 35 cgg cac agc cag ggg cgg agg aga gaa gat gcc ctg tcc tca gaa gga 259 Arg His Ser Gln Gly Arg Arg Arg Glu Asp Ala Leu Ser Ser Glu Gly 40 45 50 55 tgc ctg tgg ccc tcg gag agc aca gtg tca ggc aac gga atc cca gag 307 Cys Leu Trp Pro Ser Glu Ser Thr Val Ser Gly Asn Gly Ile Pro Glu 60 65 70 ccg cag gtc tac gcc ccg cct cgg ccc acc gac cgc ctg gcc gtg ccg 355 Pro Gln Val Tyr Ala Pro Pro Arg Pro Thr Asp Arg Leu Ala Val Pro 75 80 85 ccc ttc gcc cag cgg gag cgc ttc cac cgc ttc cag ccc acc tat ccg 403 Pro Phe Ala Gln Arg Glu Arg Phe His Arg Phe Gln Pro Thr Tyr Pro 90 95 100 tac ctg cag cac gag atc gac ctg cca ccc acc atc tcg ctg tca gac 451 Tyr Leu Gln His Glu Ile Asp Leu Pro Pro Thr Ile Ser Leu Ser Asp 105 110 115 ggg gag gag ccc cca ccc tac cag ggc ccc tgc acc ctc cag ctt cgg 499 Gly Glu Glu Pro Pro Pro Tyr Gln Gly Pro Cys Thr Leu Gln Leu Arg 120 125 130 135 gac ccc gag cag cag ctg gaa ctg aac cgg gag tcg gtg cgc gca ccc 547 Asp Pro Glu Gln Gln Leu Glu Leu Asn Arg Glu Ser Val Arg Ala Pro 140 145 150 cca aac aga acc atc ttc gac agt gac ctg atg gat agt gcc agg ctg 595 Pro Asn Arg Thr Ile Phe Asp Ser Asp Leu Met Asp Ser Ala Arg Leu 155 160 165 ggc ggc ccc tgc ccc ccc agc agt aac tcg ggc atc agc gcc acg tgc 643 Gly Gly Pro Cys Pro Pro Ser Ser Asn Ser Gly Ile Ser Ala Thr Cys 170 175 180 tac ggc agc ggc ggg cgc atg gag ggg ccg ccg ccc acc tac agc gag 691 Tyr Gly Ser Gly Gly Arg Met Glu Gly Pro Pro Pro Thr Tyr Ser Glu 185 190 195 gtc atc ggc cac tac ccg ggg tcc tcc ttc cag cac cag cag agc agt 739 Val Ile Gly His Tyr Pro Gly Ser Ser Phe Gln His Gln Gln Ser Ser 200 205 210 215 ggg ccg ccc tcc ttg ctg gag ggg acc cgg ctc cac cac aca cac atc 787 Gly Pro Pro Ser Leu Leu Glu Gly Thr Arg Leu His His Thr His Ile 220 225 230 gcg ccc cta gag agc gca gcc atc tgg agc aaa gag aag gat aaa cag 835 Ala Pro Leu Glu Ser Ala Ala Ile Trp Ser Lys Glu Lys Asp Lys Gln 235 240 245 aaa gga cac cct ctc tagggtcccc aggggggccg ggctggggct gcgtaggtga 890 Lys Gly His Pro Leu 250 aaaggcagaa cactccgcgc ttcttagaag aggagtgaga ggaaggcggg gggcgcagca 950 acgcatcgtg tggccctccc ctcccacctc cctgtgtata aatatttaca tgtgatgtct 1010 ggtctgaatg cacaagctaa gagagcttgc aaaaaaaaaa agaaaaaaga aaaaaaaaaa 1070 ccacgtttct ttgttgagct gtgtcttgaa ggcaaaagaa aaaaaatttc tacagtaaaa 1130 aaaaaaaaaa 1140 2 759 DNA Homo sapiens 2 atggcggagc tggagtttgt tcagatcatc atcatcgtgg tggtgatgat ggtgatggtg 60 gtggtgatca cgtgcctgct gagccactac aagctgtctg cacggtcctt catcagccgg 120 cacagccagg ggcggaggag agaagatgcc ctgtcctcag aaggatgcct gtggccctcg 180 gagagcacag tgtcaggcaa cggaatccca gagccgcagg tctacgcccc gcctcggccc 240 accgaccgcc tggccgtgcc gcccttcgcc cagcgggagc gcttccaccg cttccagccc 300 acctatccgt acctgcagca cgagatcgac ctgccaccca ccatctcgct gtcagacggg 360 gaggagcccc caccctacca gggcccctgc accctccagc ttcgggaccc cgagcagcag 420 ctggaactga accgggagtc ggtgcgcgca cccccaaaca gaaccatctt cgacagtgac 480 ctgatggata gtgccaggct gggcggcccc tgccccccca gcagtaactc gggcatcagc 540 gccacgtgct acggcagcgg cgggcgcatg gaggggccgc cgcccaccta cagcgaggtc 600 atcggccact acccggggtc ctccttccag caccagcaga gcagtgggcc gccctccttg 660 ctggagggga cccggctcca ccacacacac atcgcgcccc tagagagcgc agccatctgg 720 agcaaagaga aggataaaca gaaaggacac cctctctag 759 3 252 PRT Homo sapiens 3 Met Ala Glu Leu Glu Phe Val Gln Ile Ile Ile Ile Val Val Val Met 1 5 10 15 Met Val Met Val Val Val Ile Thr Cys Leu Leu Ser His Tyr Lys Leu 20 25 30 Ser Ala Arg Ser Phe Ile Ser Arg His Ser Gln Gly Arg Arg Arg Glu 35 40 45 Asp Ala Leu Ser Ser Glu Gly Cys Leu Trp Pro Ser Glu Ser Thr Val 50 55 60 Ser Gly Asn Gly Ile Pro Glu Pro Gln Val Tyr Ala Pro Pro Arg Pro 65 70 75 80 Thr Asp Arg Leu Ala Val Pro Pro Phe Ala Gln Arg Glu Arg Phe His 85 90 95 Arg Phe Gln Pro Thr Tyr Pro Tyr Leu Gln His Glu Ile Asp Leu Pro 100 105 110 Pro Thr Ile Ser Leu Ser Asp Gly Glu Glu Pro Pro Pro Tyr Gln Gly 115 120 125 Pro Cys Thr Leu Gln Leu Arg Asp Pro Glu Gln Gln Leu Glu Leu Asn 130 135 140 Arg Glu Ser Val Arg Ala Pro Pro Asn Arg Thr Ile Phe Asp Ser Asp 145 150 155 160 Leu Met Asp Ser Ala Arg Leu Gly Gly Pro Cys Pro Pro Ser Ser Asn 165 170 175 Ser Gly Ile Ser Ala Thr Cys Tyr Gly Ser Gly Gly Arg Met Glu Gly 180 185 190 Pro Pro Pro Thr Tyr Ser Glu Val Ile Gly His Tyr Pro Gly Ser Ser 195 200 205 Phe Gln His Gln Gln Ser Ser Gly Pro Pro Ser Leu Leu Glu Gly Thr 210 215 220 Arg Leu His His Thr His Ile Ala Pro Leu Glu Ser Ala Ala Ile Trp 225 230 235 240 Ser Lys Glu Lys Asp Lys Gln Lys Gly His Pro Leu 245 250 4 8 PRT Artificial Sequence Description of Artificial Sequence FLAG peptide 4 Asp Tyr Lys Asp Asp Asp Asp Lys 1 5 5 24 DNA Artificial Sequence Description of Artificial Sequence Primer 5 ggcagaacac tccgcgcttc ttag 24 6 24 DNA Artificial Sequence Description of Artificial Sequence Primer 6 caagctctct tagcttgtgc attc 24 7 22 DNA Artificial Sequence Description of Artificial Sequence Primer 7 cttgggttcg ggtgaaagcg cc 22 8 22 DNA Artificial Sequence Description of Artificial Sequence Primer 8 ggtgggtggc aggtcgatct cg 22 9 20 DNA Artificial Sequence Description of Artificial Sequence Primer 9 ccttcgccca gcgggagcgc 20 10 24 DNA Artificial Sequence Description of Artificial Sequence Primer 10 caagctctct tagcttgtgc attc 24 11 249 PRT Homo sapiens 11 Ala Glu Leu Glu Phe Val Gln Ile Ile Ile Ile Val Val Val Met Met 1 5 10 15 Val Met Val Val Val Ile Thr Cys Leu Leu Ser His Tyr Lys Leu Ser 20 25 30 Ala Arg Ser Phe Ile Ser Arg His Ser Gln Gly Arg Arg Arg Glu Asp 35 40 45 Ala Leu Ser Ser Glu Gly Cys Leu Trp Pro Ser Glu Ser Thr Val Ser 50 55 60 Gly Asn Gly Ile Pro Glu Pro Gln Val Tyr Ala Pro Pro Arg Pro Thr 65 70 75 80 Asp Arg Leu Ala Val Pro Pro Phe Ala Gln Arg Glu Arg Phe His Arg 85 90 95 Phe Gln Pro Thr Tyr Pro Tyr Leu Gln His Glu Ile Asp Leu Pro Pro 100 105 110 Thr Ile Ser Leu Ser Asp Gly Glu Glu Pro Pro Pro Tyr Gln Gly Pro 115 120 125 Cys Thr Leu Gln Leu Arg Asp Pro Glu Gln Gln Leu Glu Leu Asn Arg 130 135 140 Glu Ser Val Arg Ala Pro Pro Asn Arg Thr Ile Phe Asp Ser Asp Leu 145 150 155 160 Met Asp Ser Ala Arg Leu Gly Gly Pro Cys Pro Pro Ser Ser Asn Ser 165 170 175 Gly Ile Ser Ala Thr Cys Tyr Gly Ser Gly Gly Arg Met Glu Gly Pro 180 185 190 Pro Pro Thr Tyr Ser Glu Val Ile Gly His Tyr Pro Gly Ser Ser Phe 195 200 205 Gln His Gln Gln Ser Ser Gly Pro Pro Ser Leu Leu Glu Gly Thr Arg 210 215 220 Leu His His Thr His Ile Ala Pro Leu Glu Ser Ala Ala Ile Trp Ser 225 230 235 240 Lys Glu Lys Asp Lys Gln Lys Gly His 245 12 244 PRT Homo sapiens 12 Ala Glu Leu Glu Phe Ala Gln Ile Ile Ile Ile Val Val Val Val Thr 1 5 10 15 Val Met Val Val Val Ile Val Cys Leu Leu Asn His Tyr Lys Val Ser 20 25 30 Thr Arg Ser Phe Ile Asn Arg Pro Asn Gln Ser Arg Arg Arg Glu Asp 35 40 45 Gly Leu Pro Gln Glu Gly Cys Leu Trp Pro Ser Asp Ser Ala Ala Pro 50 55 60 Arg Leu Gly Ala Ser Glu Ile Met His Ala Pro Arg Ser Arg Asp Arg 65 70 75 80 Phe Thr Ala Pro Ser Phe Ile Gln Arg Asp Arg Phe Ser Arg Phe Gln 85 90 95 Pro Thr Tyr Pro Tyr Val Gln His Glu Ile Asp Leu Pro Pro Thr Ile 100 105 110 Ser Leu Ser Asp Gly Glu Glu Pro Pro Pro Tyr Gln Gly Pro Cys Thr 115 120 125 Leu Gln Leu Arg Asp Pro Glu Gln Gln Met Glu Leu Asn Arg Glu Ser 130 135 140 Val Arg Ala Pro Pro Asn Arg Thr Ile Phe Asp Ser Asp Leu Ile Asp 145 150 155 160 Ile Ala Met Tyr Ser Gly Gly Pro Cys Pro Pro Ser Ser Asn Ser Gly 165 170 175 Ile Ser Ala Ser Thr Cys Ser Ser Asn Gly Arg Met Glu Gly Pro Pro 180 185 190 Pro Thr Tyr Ser Glu Val Met Gly His His Pro Gly Ala Ser Phe Leu 195 200 205 His His Gln Arg Ser Asn Ala His Arg Gly Ser Arg Leu Gln Phe Gln 210 215 220 Gln Asn Asn Ala Glu Ser Thr Ile Val Pro Ile Lys Gly Lys Asp Arg 225 230 235 240 Lys Pro Gly Asn 13 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 13 gccagcccag 10 14 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 14 gtgcagggag 10 15 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 15 gacaaacatt 10 16 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 16 atgactcaag 10 17 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 17 gaaaagaagg 10 18 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 18 cctgtacccc 10 19 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 19 cctgaactgg 10 20 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 20 tgacagccca 10 21 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 21 tacaaaacca 10 22 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 22 aattctccta 10 23 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 23 tgcatatcat 10 24 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 24 cttgacacac 10 25 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 25 tgtctaacta 10 26 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 26 gtggacccca 10 27 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 27 ataaagtaac 10 28 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 28 tacattttca 10 29 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 29 tcagaacagt 10 30 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 30 caacttcaac 10 31 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 31 gataggtcgg 10 32 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 32 ctaaaaggag 10 33 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 33 gtggtgcgtg 10 34 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 34 tccccgtggc 10 35 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 35 attgatcttg 10 36 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 36 agctggtttc 10 37 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 37 cctcccccgt 10 38 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 38 atgtactctg 10 39 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 39 gatgaaatac 10 40 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 40 gtgcatcccg 10 41 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 41 gaaattaggg 10 42 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 42 tttctagggg 10 43 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 43 cccagggaga 10 44 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 44 gtggcgcaca 10 45 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 45 ttgcttttgt 10 46 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 46 atgtcctttc 10 47 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 47 tgtttatcct 10 48 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 48 gctttgtatc 10 49 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 49 gttccagtga 10 50 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 50 tagcagaggc 10 51 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 51 acaaattatg 10 52 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 52 cagtttgtac 10 53 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 53 gattacttgc 10 54 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 54 ggccagccct 10 55 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 55 caattgtaaa 10 56 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 56 aaagccaaga 10 57 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 57 caactaattc 10 58 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 58 aagagctaat 10 59 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 59 cttttcaaga 10 60 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 60 gtgtgtaaaa 10 61 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 61 acaaaatgta 10 62 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 62 aaggtagcag 10 63 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 63 ggcggggcca 10 64 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 64 ggccagtaac 10 65 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 65 aacttaagag 10 66 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 66 agggatggcc 10 67 10 DNA Artificial Sequence Description of Artificial Sequence Synthetic oligonucleotide 67 cttaaggatt 10
Claims (24)
1. A polynucleotide array comprising:
(a) a planar, non-porous solid support having at least a first surface; and
(b) a first set of polynucleotide probes attached to the first surface of the solid support, wherein the first set of polynuceotide probes comprises polynucleotide sequences derived from genes that are up-regulated or down-regulated in response to androgen.
2. The polynucleotide array of claim 1 , wherein the polynucleotide sequences are derived from the genes of LNCaP cells that are up-regulated or down-regulated in response to androgen.
3. The polynucleotide array of claim 2 , wherein the androgen is R1881.
4. The polynucleotide array of claim 1 , wherein the first set of polynuceotide probes comprises polynucleotide sequences derived from the polynucleotide sequences listed in Table 3.
5. The polynucleotide array according to claim 1 , further comprising a second set of polynucleotide probes, wherein the second set of polynucleotide probes comprises polynucleotide sequences derived from genes that are involved in testosterone biosynthesis and metabolism.
6. The polynucleotide array according to claim 4 , further comprising a second set of polynucleotide probes, wherein the second set of polynucleotide probes comprises polynucleotide sequences derived from genes whose expression is altered in prostate cancer or is specific to prostate tissue.
7. The polynucleotide array according to claim 6 , wherein the second set of polynucleotide probes comprises polynucleotide sequences derived from the polynucleotide sequences listed in Table 6.
8. The polynucleotide array according to claim 1 , further comprising a second set of polynucleotide probes, wherein the second set of polynucleotide probes comprises polynucleotide sequences derived from the polynucleotide sequences listed in Table 8.
9. The polynucleotide array according to claim 7 , further comprising a third, fourth, fifth, and sixth set of polynucleotide probes, wherein the third set of polynucleotide probes comprises polynucleotide sequences derived from the polynucleotide sequences listed in Table 4, the fourth set of polynucleotide probes comprises polynucleotide sequences derived from the polynucleotide sequences listed in Table 5, the fifth set of polynucleotide probes comprises polynucleotide sequences derived from the polynucleotide sequences listed in Table 7, and the sixth set of polynucleotide probes comprises polynucleotide sequences derived from the polynucleotide sequences listed in Table 8.
10. The polynucleotide array of claim 1 , wherein at least one of the genes that is up-regulated in response to androgen is the polynucleotide sequence of SEQ ID NO:2.
11. The polynucleotide array of claim 1 , wherein at least one of the polynucleotide sequences comprises the polynuleotide sequence of SEQ ID NO:2
12. A method of identifying an expression profile of androgen-regulated genes in a target cell, comprising hybridizing the nucleic acids of the target cell with the polynucleotide array of claim 1 to obtain a hybridization pattern, wherein the hybridization pattern represents the expression profile of androgen-regulated genes in the target cell.
13. A method of identifying an expression profile of androgen-regulated genes in a target cell, comprising hybridizing the nucleic acids of the target cell with the polynucleotide array of claim 10 to obtain a hybridization pattern, wherein the hybridization pattern represents the expression profile of androgen-regulated genes in the target cell.
14. The method acording to claim 12 , wherein the target cell is a prostate cell.
15. A method of diagnosing or prognosing prostate cancer, comprising
(a) hybridizing nucleic acids of a target cell of a patient with the polynucleotide array of claim 1 to obtain a first hybridization pattern, wherein the first hybridization pattern represents an expression profile of androgen-regulated genes in the target cell;
(b) comparing the first hybridization pattern of the target cell to a second hybridization pattern, wherein the second hybridization pattern represents an expression profile of androgen-regulated genes in prostate cancer, and
(c) diagnosing or prognosing prostate cancer in the patient.
16. A method of diagnosing or prognosing prostate cancer, comprising
(a) hybridizing nucleic acids of a target cell of a patient with the polynucleotide array of claim 10 to obtain a first hybridization pattern, wherein the first hybridization pattern represents an expression profile of androgen-regulated genes in the target cell;
(b) comparing the first hybridization pattern of the target cell to a second hybridization pattern, wherein the second hybridization pattern represents an expression profile of androgen-regulated genes in prostate cancer, and
(c) diagnosing or prognosing prostate caner in the patient.
17. The method acording to claim 15 , wherein the target cell is a prostate cell.
18. An isolated nucleic acid molecule selected from:
(a) the polynucleotide sequence of SEQ ID NO:2; and
(b) an isolated nucleic acid molecule that encodes a polypeptide having an amino acid sequence of SEQ ID NO:3.
19. A recombinant vector that directs the expression of the nucleic acid molecule of claim 18 .
20. A host cell transfected or transduced with the vector of claim 19 .
21. The host cell of claim 20 selected from bacterial cells, yeast cells, and animal cells.
22. A method of detecting prostate cancer in a patient, comprising:
(a) detecting mRNA corresponding to the polynucleotide sequence of SEQ ID NO:2 in a biological sample from the patient; and
(b) correlating the amount of mRNA corresponding to the polynucleotide sequence of SEQ ID NO:2 in the sample with the presence of prostate cancer in the patient.
23. An isolated polypeptide, comprising the amino acid sequence of SEQ ID NO:3.
24. An isolated antibody that binds to the polypeptide of claim 23.
Priority Applications (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US10/390,045 US20030170713A1 (en) | 2000-01-28 | 2003-03-18 | Method of detecting androgen-regulated gene |
US10/434,479 US20090176722A9 (en) | 2000-01-28 | 2003-05-09 | Androgen-regulated PMEPA1 gene and polypeptides |
US11/452,925 US7537896B2 (en) | 2000-01-28 | 2006-06-15 | Androgen-regulated PMEPA1 gene and polypeptides |
Applications Claiming Priority (4)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US17877200P | 2000-01-28 | 2000-01-28 | |
US17904500P | 2000-01-31 | 2000-01-31 | |
US09/769,482 US6566130B1 (en) | 2000-01-28 | 2001-01-26 | Androgen-regulated gene expressed in prostate tissue |
US10/390,045 US20030170713A1 (en) | 2000-01-28 | 2003-03-18 | Method of detecting androgen-regulated gene |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US09/769,482 Division US6566130B1 (en) | 2000-01-28 | 2001-01-26 | Androgen-regulated gene expressed in prostate tissue |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/434,479 Continuation-In-Part US20090176722A9 (en) | 2000-01-28 | 2003-05-09 | Androgen-regulated PMEPA1 gene and polypeptides |
Publications (1)
Publication Number | Publication Date |
---|---|
US20030170713A1 true US20030170713A1 (en) | 2003-09-11 |
Family
ID=27391020
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US09/769,482 Expired - Lifetime US6566130B1 (en) | 2000-01-28 | 2001-01-26 | Androgen-regulated gene expressed in prostate tissue |
US10/390,045 Abandoned US20030170713A1 (en) | 2000-01-28 | 2003-03-18 | Method of detecting androgen-regulated gene |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US09/769,482 Expired - Lifetime US6566130B1 (en) | 2000-01-28 | 2001-01-26 | Androgen-regulated gene expressed in prostate tissue |
Country Status (1)
Country | Link |
---|---|
US (2) | US6566130B1 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10260104B2 (en) | 2010-07-27 | 2019-04-16 | Genomic Health, Inc. | Method for using gene expression to determine prognosis of prostate cancer |
Families Citing this family (12)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US20080050836A1 (en) * | 1998-05-01 | 2008-02-28 | Isabelle Guyon | Biomarkers for screening, predicting, and monitoring benign prostate hyperplasia |
US20090176722A9 (en) | 2000-01-28 | 2009-07-09 | Shiv Srivastava | Androgen-regulated PMEPA1 gene and polypeptides |
US20090226915A1 (en) | 2001-01-24 | 2009-09-10 | Health Discovery Corporation | Methods for Screening, Predicting and Monitoring Prostate Cancer |
US8008012B2 (en) | 2002-01-24 | 2011-08-30 | Health Discovery Corporation | Biomarkers downregulated in prostate cancer |
JP4744140B2 (en) * | 2002-05-10 | 2011-08-10 | ザ・ヘンリー・エム・ジャクソン・ファンデイション・フォー・ジ・アドヴァンスメント・オヴ・ミリタリー・メディシン、インコーポレイテッド | Androgen-regulated PMEPA1 gene and method of using the same for inhibiting cancer cell proliferation |
US7542854B2 (en) * | 2004-07-22 | 2009-06-02 | International Business Machines Corporation | Method for discovering gene regulatory models and genetic networks using relational fuzzy models |
US11105808B2 (en) | 2004-11-12 | 2021-08-31 | Health Discovery Corporation | Methods for screening, predicting and monitoring prostate cancer |
WO2006053328A2 (en) * | 2004-11-12 | 2006-05-18 | Health Discovery Corporation | Biomarkers for screening, predicting, and monitoring prostate disease |
WO2008112283A2 (en) * | 2007-03-12 | 2008-09-18 | Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Microrna profiling of androgen responsiveness for predicting the appropriate prostate cancer treatment |
GB0921873D0 (en) * | 2009-12-15 | 2010-01-27 | Cytosystems Ltd | Assay |
EP2549399A1 (en) * | 2011-07-19 | 2013-01-23 | Koninklijke Philips Electronics N.V. | Assessment of Wnt pathway activity using probabilistic modeling of target gene expression |
UY34813A (en) | 2012-05-18 | 2013-11-29 | Amgen Inc | ANTIGEN UNION PROTEINS DIRECTED AGAINST ST2 RECEIVER |
Citations (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5695937A (en) * | 1995-09-12 | 1997-12-09 | The Johns Hopkins University School Of Medicine | Method for serial analysis of gene expression |
US5744305A (en) * | 1989-06-07 | 1998-04-28 | Affymetrix, Inc. | Arrays of materials attached to a substrate |
US5837832A (en) * | 1993-06-25 | 1998-11-17 | Affymetrix, Inc. | Arrays of nucleic acid probes on biological chips |
US5861242A (en) * | 1993-06-25 | 1999-01-19 | Affymetrix, Inc. | Array of nucleic acid probes on biological chips for diagnosis of HIV and methods of using the same |
US5866330A (en) * | 1995-09-12 | 1999-02-02 | The Johns Hopkins University School Of Medicine | Method for serial analysis of gene expression |
US6312922B1 (en) * | 1998-02-09 | 2001-11-06 | Genset | Complementary DNAs |
US20030027998A1 (en) * | 1998-10-30 | 2003-02-06 | Holtzman Douglas A. | Novel genes encoding proteins having prognostic, diagnostic, preventive, therapeutic, and other uses |
US20030108963A1 (en) * | 2001-07-25 | 2003-06-12 | Millennium Pharmaceuticals, Inc. | Novel genes, compositions, kit, and methods for identification, assessment, prevention and therapy of prostate cancer |
US20030148314A1 (en) * | 2001-08-01 | 2003-08-07 | Millennium Pharmaceuticals, Inc. | Compositions, kits, and methods for identification, assessment, prevention, and therapy of colon cancer |
US20050266493A1 (en) * | 2001-12-10 | 2005-12-01 | Millennium Pharmaceuticals, Inc. | Novel genes, compositions, kits, and methods for identification, assessment, prevention, and therapy of colon cancer |
-
2001
- 2001-01-26 US US09/769,482 patent/US6566130B1/en not_active Expired - Lifetime
-
2003
- 2003-03-18 US US10/390,045 patent/US20030170713A1/en not_active Abandoned
Patent Citations (11)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5744305A (en) * | 1989-06-07 | 1998-04-28 | Affymetrix, Inc. | Arrays of materials attached to a substrate |
US5837832A (en) * | 1993-06-25 | 1998-11-17 | Affymetrix, Inc. | Arrays of nucleic acid probes on biological chips |
US5861242A (en) * | 1993-06-25 | 1999-01-19 | Affymetrix, Inc. | Array of nucleic acid probes on biological chips for diagnosis of HIV and methods of using the same |
US5695937A (en) * | 1995-09-12 | 1997-12-09 | The Johns Hopkins University School Of Medicine | Method for serial analysis of gene expression |
US5866330A (en) * | 1995-09-12 | 1999-02-02 | The Johns Hopkins University School Of Medicine | Method for serial analysis of gene expression |
US6312922B1 (en) * | 1998-02-09 | 2001-11-06 | Genset | Complementary DNAs |
US20030027998A1 (en) * | 1998-10-30 | 2003-02-06 | Holtzman Douglas A. | Novel genes encoding proteins having prognostic, diagnostic, preventive, therapeutic, and other uses |
US20030108963A1 (en) * | 2001-07-25 | 2003-06-12 | Millennium Pharmaceuticals, Inc. | Novel genes, compositions, kit, and methods for identification, assessment, prevention and therapy of prostate cancer |
US20050191673A1 (en) * | 2001-07-25 | 2005-09-01 | Millennium Pharmaceuticals , Inc. | Novel genes, compositions, kits, and methods for identification, assessment, prevention, and therapy of prostate cancer |
US20030148314A1 (en) * | 2001-08-01 | 2003-08-07 | Millennium Pharmaceuticals, Inc. | Compositions, kits, and methods for identification, assessment, prevention, and therapy of colon cancer |
US20050266493A1 (en) * | 2001-12-10 | 2005-12-01 | Millennium Pharmaceuticals, Inc. | Novel genes, compositions, kits, and methods for identification, assessment, prevention, and therapy of colon cancer |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US10260104B2 (en) | 2010-07-27 | 2019-04-16 | Genomic Health, Inc. | Method for using gene expression to determine prognosis of prostate cancer |
Also Published As
Publication number | Publication date |
---|---|
US6566130B1 (en) | 2003-05-20 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Xu et al. | A novel androgen-regulated gene, PMEPA1, located on chromosome 20q13 exhibits high level expression in prostate | |
Miller et al. | Aberrant HOXC expression accompanies the malignant phenotype in human prostate | |
US6566130B1 (en) | Androgen-regulated gene expressed in prostate tissue | |
Pflueger et al. | N-myc downstream regulated gene 1 (NDRG1) is fused to ERG in prostate cancer | |
CN101305020B (en) | For the diagnosis and treatment of the qualification of tumor associated antigen | |
Xu et al. | Quantitative expression profile of androgen‐regulated genes in prostate cancer cells and identification of prostate‐specific genes | |
JP3496071B2 (en) | Isolated nucleic acid molecule encoding tumor rejection antigen precursor DAGE and methods of use thereof | |
US7537896B2 (en) | Androgen-regulated PMEPA1 gene and polypeptides | |
US20030190640A1 (en) | Genes expressed in prostate cancer | |
KR20110084995A (en) | Recurrent gene fusions in prostate cancer | |
CA2500472A1 (en) | Genes and polypeptides relating to human pancreatic cancers | |
EP1053319A2 (en) | Human genes and gene expression products ii | |
JP2002543854A (en) | Expression of ETS domain protein in cancer | |
KR20050067409A (en) | Genes and polypeptides relating to prostate cancers | |
EP1185639B1 (en) | Prostate-specific gene, pcgem1, and methods of using pcgem1 to detect, treat, and prevent prostate cancer | |
US20030215803A1 (en) | Human genes and gene expression products isolated from human prostate | |
US7022819B2 (en) | Isolated nucleic acid molecule coding for tumor rejection antigen precursors MAGE-C1 and MAGE-C2 and uses thereof | |
US20060234246A1 (en) | Gene products differentially expressed in cancerous cells | |
JP2004527240A (en) | Polynucleotides useful for regulating the growth of cancer cells | |
Herness et al. | Prostate-specific genes: present status and future direction | |
EP1379651A2 (en) | Human genes and gene expression products isolated from human prostate | |
US7108977B2 (en) | Process for determining the tumoricidal potential of a sample the use of a nucleic acid which is downregulated in human tumor cells | |
US20030219761A1 (en) | Novel prostate-specific or test-specific nucleic acid molecules, polypeptides, and diagnostic and therapeutic methods | |
US20030104418A1 (en) | Diagnostic markers for breast cancer | |
CA2322713C (en) | Process for the determination of ctp11 and for determining whether a tumor sample has metastatic potential |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |